AGP5.1 (Potri.005G161100) [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol AGP5.1
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G101101 40 / 0.0001 ND /
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.005G161100.2 pacid=42804659 polypeptide=Potri.005G161100.2.p locus=Potri.005G161100 ID=Potri.005G161100.2.v4.1 annot-version=v4.1
ATGGCTTACAAAACCTTGGTGTGCTTGATGCTTTTGGCTCTCTTAGCTGGTTCAGCCTTGGCTCAGGCACCAGGAGCCGCACCAACAGCTCAACCAACCA
AATCACCATCTCCTGCACCCGCTGCACCTACAACTCCACCTCCCGCTCCAACTCCCGCTCCATCAGTCCCTGCTCCAACTCCCGCTCCATCAGTCCCTGC
TCCAACTCCTGCTACCGCTCCATCCACATCTCCTTCTTCGTCTCCGGCCAGCTCACCACCTTCTCCCTTGGCCCCTGGTACTGGTGGCGGCTCCATAGCC
ACTCCTCCAAGTGACACCGCTTCTCCTCCATCTCCTTCGAACGCGGATGGCTTGAACAGAGCCACGATGGCTGGTGCTTTGATTGGAGTGGCTGGTGTGT
GGTCTTTGTTGATGTAG
AA sequence
>Potri.005G161100.2 pacid=42804659 polypeptide=Potri.005G161100.2.p locus=Potri.005G161100 ID=Potri.005G161100.2.v4.1 annot-version=v4.1
MAYKTLVCLMLLALLAGSALAQAPGAAPTAQPTKSPSPAPAAPTTPPPAPTPAPSVPAPTPAPSVPAPTPATAPSTSPSSSPASSPPSPLAPGTGGGSIA
TPPSDTASPPSPSNADGLNRATMAGALIGVAGVWSLLM

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.005G161100 0 1 AGP5.1
AT5G67210 IRX15-L IRX15-LIKE, Protein of unknown... Potri.009G098800 6.48 0.8052
AT3G07320 O-Glycosyl hydrolases family 1... Potri.002G247900 9.16 0.7659 SGGN1.2
AT3G57450 unknown protein Potri.009G058500 15.81 0.7951
AT3G05650 AtRLP32 receptor like protein 32 (.1) Potri.012G008911 21.44 0.7715
AT4G17880 bHLH bHLH004, MYC4 Basic helix-loop-helix (bHLH) ... Potri.002G176900 31.17 0.7662
AT2G24130 Leucine-rich receptor-like pro... Potri.005G030519 33.31 0.7664
AT1G02170 AtMCP1b, ATMC1,... LSD ONE LIKE 3, ARABIDOPSIS TH... Potri.012G113100 41.02 0.7623
AT5G49620 MYB ATMYB78 myb domain protein 78 (.1.2) Potri.014G117000 44.27 0.7630 Pt-MYB.47
AT4G34980 SLP2 subtilisin-like serine proteas... Potri.009G100500 48.10 0.7557
AT3G18670 Ankyrin repeat family protein ... Potri.006G062900 66.85 0.7502

Potri.005G161100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.