Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G40080 144 / 8e-47 Mitochondrial ribosomal protein L27 (.1) AT4G09012 137 / 5e-43 Mitochondrial ribosomal protein L27 (.1) AT5G39800 128 / 2e-40 Mitochondrial ribosomal protein L27 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G070700 [exp] 177 / 7e-60 AT5G40080 150 / 4e-49 Mitochondrial ribosomal protein L27 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10003002 [exp] 171 / 2e-57 AT5G40080 147 / 4e-48 Mitochondrial ribosomal protein L27 (.1) Lus10011032 [exp] 169 / 2e-56 AT5G40080 146 / 2e-47 Mitochondrial ribosomal protein L27 (.1) Lus10034241 [exp] 163 / 5e-54 AT5G40080 137 / 5e-44 Mitochondrial ribosomal protein L27 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF09809 [poplar] [flax] MRP-L27 Mitochondrial ribosomal protein L27
Representative CDS sequence Show only first row Show all	>Potri.005G161600.2 pacid=42804193 polypeptide=Potri.005G161600.2.p locus=Potri.005G161600 ID=Potri.005G161600.2.v4.1 annot-version=v4.1 ATGCCGTTGGGATTGATAACCGGGATAGGGAGGGCGATGAGGAGGAAGCGGACGTCGTCGCTGGACATTCTTTCGTCAAAACGTGCTCCCCGTAATTACT ACAAGGGAAAGAATTGCAAGCCCACGGGTTTTCACACTCGTAAAGGTGGGTATGTTGTTGTACCGGAGAAACTGCCCAACTATGTAGTCCCTGATTTGAC AGACTTCATGCTCAAACCATTTGTGTCTCAATGTCAGACGGATGTTAAAACAACTGAAGCATCTGAATCTGCTAAGTAG
AA sequence Show only first row Show all	>Potri.005G161600.2 pacid=42804193 polypeptide=Potri.005G161600.2.p locus=Potri.005G161600 ID=Potri.005G161600.2.v4.1 annot-version=v4.1 MPLGLITGIGRAMRRKRTSSLDILSSKRAPRNYYKGKNCKPTGFHTRKGGYVVVPEKLPNYVVPDLTDFMLKPFVSQCQTDVKTTEASESAK

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G40080			Mitochondrial ribosomal protei...		Potri.005G161600 [exp]	0	1
AT2G29530		TIM10	Tim10/DDP family zinc finger p...		Potri.001G246500 [exp]	2.00	0.8342
AT2G22610			Di-glucose binding protein wit...		Potri.002G110600 [exp]	2.00	0.8156
					Potri.005G070800 [exp]	2.64	0.7416
					Potri.011G126600 [exp]	4.58	0.7862
					Potri.010G104050 [exp]	7.93	0.7132
AT3G60830		ATARP7	actin-related protein 7 (.1)		Potri.009G060200 [exp]	20.68	0.6701	ARP902,Pt-ARP7.2
AT3G49100			Signal recognition particle, S...		Potri.005G219400 [exp]	24.49	0.7431
AT3G08880			unknown protein		Potri.012G107200 [exp]	30.29	0.7012
AT3G25980		MAD2	MITOTIC ARREST-DEFICIENT 2, DN...		Potri.010G055100 [exp]	30.98	0.7018	MAD2.2
AT1G12400			Nucleotide excision repair, TF...		Potri.009G138800 [exp]	38.97	0.7019

Compare expression of checked genes

Potri.005G161600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.