Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G08570 229 / 1e-78 Heavy metal transport/detoxification superfamily protein (.1) AT4G39700 174 / 2e-56 Heavy metal transport/detoxification superfamily protein (.1) AT1G22990 172 / 4e-56 HIPP22 heavy metal associated isoprenylated plant protein 22, Heavy metal transport/detoxification superfamily protein (.1) AT1G71050 154 / 8e-49 HIPP20 heavy metal associated isoprenylated plant protein 20, Heavy metal transport/detoxification superfamily protein (.1) AT4G38580 152 / 6e-48 HIPP26, ATFP6 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1) AT5G66110 143 / 2e-44 HIPP27 heavy metal associated isoprenylated plant protein 27, Heavy metal transport/detoxification superfamily protein (.1) AT5G17450 131 / 5e-40 HIPP21 heavy metal associated isoprenylated plant protein 21, Heavy metal transport/detoxification superfamily protein (.1.2) AT4G35060 129 / 8e-39 HIPP25 heavy metal associated isoprenylated plant protein 25, Heavy metal transport/detoxification superfamily protein (.1) AT1G06330 100 / 1e-27 Heavy metal transport/detoxification superfamily protein (.1) AT2G18196 92 / 6e-24 Heavy metal transport/detoxification superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G092200 [exp] 288 / 6e-102 AT4G08570 193 / 3e-64 Heavy metal transport/detoxification superfamily protein (.1) Potri.005G003700 [exp] 258 / 7e-90 AT4G08570 207 / 5e-70 Heavy metal transport/detoxification superfamily protein (.1) Potri.007G087300 [exp] 192 / 7e-64 AT4G39700 215 / 9e-73 Heavy metal transport/detoxification superfamily protein (.1) Potri.005G079800 [exp] 182 / 8e-60 AT4G39700 189 / 2e-62 Heavy metal transport/detoxification superfamily protein (.1) Potri.010G114600 [exp] 181 / 2e-59 AT1G22990 194 / 9e-65 heavy metal associated isoprenylated plant protein 22, Heavy metal transport/detoxification superfamily protein (.1) Potri.004G175400 [exp] 162 / 8e-52 AT4G38580 254 / 2e-88 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1) Potri.009G135300 [exp] 157 / 6e-50 AT4G38580 234 / 3e-80 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1) Potri.017G123400 [exp] 155 / 2e-49 AT5G17450 220 / 4e-75 heavy metal associated isoprenylated plant protein 21, Heavy metal transport/detoxification superfamily protein (.1.2) Potri.005G110400 [exp] 127 / 3e-38 AT5G66110 189 / 2e-62 heavy metal associated isoprenylated plant protein 27, Heavy metal transport/detoxification superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039419 [exp] 246 / 3e-85 AT4G08570 215 / 5e-73 Heavy metal transport/detoxification superfamily protein (.1) Lus10016436 [exp] 196 / 4e-65 AT4G39700 209 / 1e-70 Heavy metal transport/detoxification superfamily protein (.1) Lus10019676 [exp] 194 / 2e-64 AT4G39700 211 / 3e-71 Heavy metal transport/detoxification superfamily protein (.1) Lus10036004 [exp] 178 / 3e-58 AT1G22990 187 / 4e-62 heavy metal associated isoprenylated plant protein 22, Heavy metal transport/detoxification superfamily protein (.1) Lus10016708 [exp] 177 / 7e-58 AT1G71050 192 / 1e-63 heavy metal associated isoprenylated plant protein 20, Heavy metal transport/detoxification superfamily protein (.1) Lus10022508 [exp] 173 / 3e-56 AT4G39700 201 / 2e-67 Heavy metal transport/detoxification superfamily protein (.1) Lus10042946 [exp] 164 / 8e-53 AT1G71050 196 / 3e-65 heavy metal associated isoprenylated plant protein 20, Heavy metal transport/detoxification superfamily protein (.1) Lus10016812 [exp] 155 / 6e-49 AT4G39700 181 / 3e-59 Heavy metal transport/detoxification superfamily protein (.1) Lus10014120 [exp] 152 / 5e-48 AT4G38580 253 / 5e-88 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1) Lus10019789 [exp] 152 / 9e-48 AT4G38580 254 / 4e-88 HEAVY METAL ASSOCIATED ISOPRENYLATED PLANT PROTEIN 26, farnesylated protein 6 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00403 [poplar] [flax] HMA Heavy-metal-associated domain
Representative CDS sequence Show only first row Show all	>Potri.005G167000.1 pacid=42802720 polypeptide=Potri.005G167000.1.p locus=Potri.005G167000 ID=Potri.005G167000.1.v4.1 annot-version=v4.1 ATGGGAGTTGCAGGAACTTTGGAGTACTTCTCTGATTTACTAAGCAATGTCAAGAAGGGCAAGAAAAGGAAGCAAATGCAAACTGTAGCACTCAAAGTCA GGATGGACTGCGAGGGCTGTGAACGTAAGATCAAGAGTGTCCTCTCCGGAGTTAAAGGTGCTAAATCTGTGGACGTCGACATGAAGCAACAAAAGGTGAC TGTGACTGGGTACGTAGAGCCAAAGAAAGTGTTGAAGGCAGCTCAATCGACAAAGAAGAAGGTAGAGATGTGGCCTTATGTGCCATACACTTTAGTGGCA AACCCCTATGTTTCACAAGCATATGACAAGAAAGCACCTGCTAATCATGTCAGAGCCGTTCCGGTCACCGCCACCATCAGCGAGACCACCATGGACGACA ACTACACCAACATGTTTAGTGATGAGAACCCCAATGCCTGTTCCATCATGTAG
AA sequence Show only first row Show all	>Potri.005G167000.1 pacid=42802720 polypeptide=Potri.005G167000.1.p locus=Potri.005G167000 ID=Potri.005G167000.1.v4.1 annot-version=v4.1 MGVAGTLEYFSDLLSNVKKGKKRKQMQTVALKVRMDCEGCERKIKSVLSGVKGAKSVDVDMKQQKVTVTGYVEPKKVLKAAQSTKKKVEMWPYVPYTLVA NPYVSQAYDKKAPANHVRAVPVTATISETTMDDNYTNMFSDENPNACSIM

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G08570			Heavy metal transport/detoxifi...		Potri.005G167000 [exp]	0	1
AT5G24080			Protein kinase superfamily pro...		Potri.015G026300 [exp]	3.16	0.8822
					Potri.010G196500 [exp]	5.29	0.8384
AT2G38905			Low temperature and salt respo...		Potri.010G217200 [exp]	6.92	0.8724
AT5G66440			unknown protein		Potri.002G033100 [exp]	7.93	0.8784
AT4G24040		TREHALASE1, ATT...	trehalase 1 (.1)		Potri.003G143900 [exp]	10.67	0.7682
AT4G13620	AP2_ERF		Integrase-type DNA-binding sup...		Potri.017G055400 [exp]	13.67	0.8239
AT3G06490	MYB	BOS1, AtMYB108	BOTRYTIS-SUSCEPTIBLE1, myb dom...		Potri.010G149900 [exp]	14.49	0.8601
AT3G04070	NAC	ANAC047	NAC domain containing protein ...		Potri.019G031400 [exp]	14.89	0.8429
AT1G24020		MLP423	MLP-like protein 423 (.1.2)		Potri.016G046500 [exp]	15.49	0.7908
AT1G11925			Stigma-specific Stig1 family p...		Potri.004G007100 [exp]	16.12	0.8283

Compare expression of checked genes

Potri.005G167000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.