Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	Pt-SAH7.2
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G08685 171 / 2e-55 SAH7 Pollen Ole e 1 allergen and extensin family protein (.1) AT1G78040 124 / 1e-36 Pollen Ole e 1 allergen and extensin family protein (.1.2) AT5G10130 118 / 2e-34 Pollen Ole e 1 allergen and extensin family protein (.1) AT1G29140 105 / 2e-29 Pollen Ole e 1 allergen and extensin family protein (.1) AT5G45880 105 / 4e-29 Pollen Ole e 1 allergen and extensin family protein (.1) AT4G18596 102 / 5e-28 Pollen Ole e 1 allergen and extensin family protein (.1) AT5G05500 50 / 8e-08 MOP10 Pollen Ole e 1 allergen and extensin family protein (.1) AT5G15780 45 / 4e-06 Pollen Ole e 1 allergen and extensin family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G093100 [exp] 245 / 2e-84 AT4G08685 199 / 3e-66 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.005G078200 [exp] 144 / 8e-45 AT4G08685 165 / 5e-53 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.007G090100 [exp] 139 / 1e-42 AT4G08685 152 / 1e-47 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.011G111300 [exp] 121 / 1e-35 AT1G29140 148 / 4e-46 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.001G392400 [exp] 111 / 8e-32 AT1G29140 137 / 1e-41 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.004G114300 [exp] 50 / 1e-07 AT5G15780 178 / 5e-52 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.006G005600 [exp] 47 / 5e-07 AT5G47635 120 / 8e-35 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.017G100600 [exp] 44 / 2e-05 AT5G15780 173 / 1e-49 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.010G185400 [exp] 42 / 3e-05 AT5G05500 166 / 8e-53 Pollen Ole e 1 allergen and extensin family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042201 [exp] 175 / 7e-57 AT4G08685 171 / 3e-55 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10008615 [exp] 173 / 7e-56 AT4G08685 166 / 3e-53 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10014332 [exp] 150 / 8e-47 AT5G10130 154 / 2e-48 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10026040 [exp] 144 / 1e-44 AT5G10130 159 / 3e-50 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10041707 [exp] 141 / 2e-43 AT5G10130 150 / 9e-47 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10001895 [exp] 109 / 8e-31 AT1G29140 157 / 2e-49 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10028134 [exp] 108 / 2e-30 AT1G29140 118 / 4e-34 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10042838 [exp] 107 / 5e-30 AT1G29140 115 / 6e-33 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10013681 [exp] 107 / 9e-30 AT1G29140 117 / 6e-34 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10017940 [exp] 105 / 3e-29 AT1G29140 117 / 8e-34 Pollen Ole e 1 allergen and extensin family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0287 [poplar] [flax] Transthyretin PF01190 [poplar] [flax] Pollen_Ole_e_1 Pollen protein Ole e 1 like
Representative CDS sequence Show only first row Show all	>Potri.005G167900.1 pacid=42803184 polypeptide=Potri.005G167900.1.p locus=Potri.005G167900 ID=Potri.005G167900.1.v4.1 annot-version=v4.1 ATGGCTCGAGTGCTTTTGTTGCTTGCTCTATGTGTGCTACCAGCCCTCGTAAGAGCTGCTCGCCCAGCGAGAAACCCATTTGTGGTTCAAGGGAGCGTCT ACTGTGACACTTGCCTTGCTGGTTTTGAAACCTCCAAGACCACTAACATTGCAGGTGCGAAGGTTAGACTGGAATGCAAGGACAGAAAGACACAAGATCT TGTCTACAGCAAGGAAGGAACAACAGACTCAACTGGAAAATACACCATCACTGTTGATGAGGACCATGAGGATCAGATTTGCGATTGCATGCTAGTTAGC AGCCCCCGGAAGGACTGCCGATCACCATCTGCTGGCCGTGATCGTGCCCGTGTTATCTTGACCAATGACAATGGACTTGTGTCAACTACCCGTTATGCCA ATGCTATGGGTTTCATGGCAGCACAGCCCATGTCTGGCTGCACTGAGCTTCTCAGGTTATACCAGGAGTACGAAGATTAG
AA sequence Show only first row Show all	>Potri.005G167900.1 pacid=42803184 polypeptide=Potri.005G167900.1.p locus=Potri.005G167900 ID=Potri.005G167900.1.v4.1 annot-version=v4.1 MARVLLLLALCVLPALVRAARPARNPFVVQGSVYCDTCLAGFETSKTTNIAGAKVRLECKDRKTQDLVYSKEGTTDSTGKYTITVDEDHEDQICDCMLVS SPRKDCRSPSAGRDRARVILTNDNGLVSTTRYANAMGFMAAQPMSGCTELLRLYQEYED

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G08685		SAH7	Pollen Ole e 1 allergen and ex...		Potri.005G167900 [exp]	0	1	Pt-SAH7.2
AT3G08900		RGP3	reversibly glycosylated polype...		Potri.008G097600 [exp]	2.44	0.9460	Pt-RGP3.4
AT3G50150			Plant protein of unknown funct...		Potri.016G040100 [exp]	2.44	0.9277
AT4G18760		AtRLP51	receptor like protein 51 (.1)		Potri.011G069500 [exp]	4.89	0.9290
AT3G62060			Pectinacetylesterase family pr...		Potri.014G110900 [exp]	5.91	0.9193
AT5G02280			SNARE-like superfamily protein...		Potri.009G069800 [exp]	6.32	0.9199
AT5G18610			Protein kinase superfamily pro...		Potri.010G215100 [exp]	8.48	0.9124
AT2G34770		ATFAH1, FAH1	ARABIDOPSIS FATTY ACID HYDROXY...		Potri.011G162000 [exp]	10.09	0.9197	Pt-FAH1.1
AT3G61640		AGP20, ATAGP20	arabinogalactan protein 20 (.1...		Potri.014G094800 [exp]	10.39	0.9213	AGP20.1
AT2G21160			Translocon-associated protein ...		Potri.009G129800 [exp]	11.66	0.9148
AT5G03040		IQD2	IQ-domain 2 (.1.2.3)		Potri.006G131100 [exp]	13.22	0.8951

Compare expression of checked genes

Potri.005G167900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.