Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G46070 113 / 5e-31 Guanylate-binding family protein (.1) AT1G03830 66 / 2e-14 guanylate-binding family protein (.1.2) AT2G38840 39 / 5e-05 Guanylate-binding family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G058500 [exp] 118 / 6e-33 AT5G46070 1355 / 0.0 Guanylate-binding family protein (.1) Potri.004G049400 [exp] 116 / 3e-32 AT5G46070 1334 / 0.0 Guanylate-binding family protein (.1) Potri.017G016800 [exp] 102 / 3e-27 AT5G46070 928 / 0.0 Guanylate-binding family protein (.1) Potri.002G046000 [exp] 37 / 0.0004 AT2G38840 1011 / 0.0 Guanylate-binding family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015327 [exp] 115 / 6e-32 AT5G46070 1415 / 0.0 Guanylate-binding family protein (.1) Lus10025456 [exp] 115 / 7e-32 AT5G46070 1401 / 0.0 Guanylate-binding family protein (.1) Lus10013965 [exp] 114 / 3e-31 AT5G46070 1390 / 0.0 Guanylate-binding family protein (.1) Lus10015390 [exp] 111 / 2e-30 AT5G46070 1392 / 0.0 Guanylate-binding family protein (.1) Lus10018638 [exp] 69 / 2e-15 AT5G46070 526 / 2e-169 Guanylate-binding family protein (.1) Lus10024841 [exp] 37 / 0.0006 AT2G38840 976 / 0.0 Guanylate-binding family protein (.1) Lus10014720 [exp] 37 / 0.0006 AT2G38840 976 / 0.0 Guanylate-binding family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0023 [poplar] [flax] P-loop_NTPase PF02263 [poplar] [flax] GBP Guanylate-binding protein, N-terminal domain
Representative CDS sequence Show only first row Show all	>Potri.005G168402.1 pacid=42805170 polypeptide=Potri.005G168402.1.p locus=Potri.005G168402 ID=Potri.005G168402.1.v4.1 annot-version=v4.1 ATGTTCAAGATTGAAATTTTTCAGCTTCTTGGCAGGAGTAGTGGATTTCAAGTAGCATCCACTCATCGGCCATGTACAAAAGGACTTTGGTTGTGGAGTG CACCGTTAAAGAGAACTGCCCTTGATGGAACTCAGTACAATCTCTTACTGTTAGACAGTGAAGGAATAGATGCTTATGATCAAACAGTAAGTGCATTTAC CTTATCAAGATGA
AA sequence Show only first row Show all	>Potri.005G168402.1 pacid=42805170 polypeptide=Potri.005G168402.1.p locus=Potri.005G168402 ID=Potri.005G168402.1.v4.1 annot-version=v4.1 MFKIEIFQLLGRSSGFQVASTHRPCTKGLWLWSAPLKRTALDGTQYNLLLLDSEGIDAYDQTVSAFTLSR

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G46070			Guanylate-binding family prote...		Potri.005G168402 [exp]	0	1
					Potri.012G100300 [exp]	20.44	0.8893
AT3G63088		RTFL14, DVL14	DEVIL 14, ROTUNDIFOLIA like 14...		Potri.008G202000 [exp]	26.94	0.8114
AT2G13620		ATCHX15	CATION/H+ EXCHANGER 15, cation...		Potri.019G123800 [exp]	29.69	0.8652
AT5G53040		GRD, RKD4	RWP-RK domain-containing 4, GR...		Potri.012G016800 [exp]	33.66	0.8615
					Potri.001G076350 [exp]	66.09	0.8336
AT4G28670			Protein kinase family protein ...		Potri.007G056000 [exp]	73.44	0.8220
AT4G32480			Protein of unknown function (D...		Potri.011G053300 [exp]	85.00	0.8474
AT4G27450			Aluminium induced protein with...		Potri.011G049900 [exp]	193.65	0.8101
AT3G63470		SCPL40	serine carboxypeptidase-like 4...		Potri.001G261201 [exp]	217.49	0.7871
AT1G70260			nodulin MtN21 /EamA-like trans...		Potri.010G096100 [exp]	218.65	0.7753	N21L6

Compare expression of checked genes

Potri.005G168402 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.