Potri.005G170200 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G035600 93 / 7e-27 ND /
Potri.005G170132 47 / 2e-08 ND /
Potri.002G091600 46 / 2e-08 ND /
Potri.005G081100 37 / 0.0002 ND /
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.005G170200.1 pacid=42805185 polypeptide=Potri.005G170200.1.p locus=Potri.005G170200 ID=Potri.005G170200.1.v4.1 annot-version=v4.1
ATGGCAACTCCTGGGTATTGTATAGCTGAAGCATATGTGTCGCGAAAGCTACACACAGATAAATTGAAGAGAATGGAAGAAGATCAGAAGGCTAAGATAG
ATGGCGATGATGATGAAGTGAAACAACAAAGTGGTTGTTTCTTATCCATCTTTAATAAAGTCCATCCAGCTCGAACTGTGTCGAAGGATCGAGCAGGAAA
TGAAGCACAGAGGCTGGATTCTAAGGGGTGA
AA sequence
>Potri.005G170200.1 pacid=42805185 polypeptide=Potri.005G170200.1.p locus=Potri.005G170200 ID=Potri.005G170200.1.v4.1 annot-version=v4.1
MATPGYCIAEAYVSRKLHTDKLKRMEEDQKAKIDGDDDEVKQQSGCFLSIFNKVHPARTVSKDRAGNEAQRLDSKG

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.005G170200 0 1
AT1G18210 Calcium-binding EF-hand family... Potri.014G030100 2.00 0.8651
Potri.015G098500 3.00 0.8497
Potri.007G062362 4.89 0.7761
Potri.009G016950 5.29 0.8520
AT5G66580 unknown protein Potri.009G110700 10.00 0.8237
AT4G25225 unknown protein Potri.014G059600 13.74 0.7685
Potri.010G007855 16.88 0.7853
AT3G22370 AtHSR3, ATAOX1A... hyper-sensitivity-related 3, a... Potri.012G001500 20.61 0.7912
AT3G56630 CYP94D2 "cytochrome P450, family 94, s... Potri.001G277301 24.00 0.7378
AT2G04160 AIR3 AUXIN-INDUCED IN ROOT CULTURES... Potri.011G050000 28.77 0.8022

Potri.005G170200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.