Potri.005G173900 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G77700 315 / 4e-107 Pathogenesis-related thaumatin superfamily protein (.1)
AT1G75030 206 / 6e-66 ATLP-3 thaumatin-like protein 3 (.1)
AT1G18250 201 / 3e-64 ATLP-1 Pathogenesis-related thaumatin superfamily protein (.1.2)
AT1G75050 200 / 1e-63 Pathogenesis-related thaumatin superfamily protein (.1)
AT1G73620 199 / 8e-63 Pathogenesis-related thaumatin superfamily protein (.1)
AT1G75040 196 / 3e-62 PR-5, PR5 pathogenesis-related gene 5 (.1)
AT1G19320 188 / 4e-59 Pathogenesis-related thaumatin superfamily protein (.1)
AT2G17860 183 / 6e-57 Pathogenesis-related thaumatin superfamily protein (.1)
AT4G36010 184 / 1e-56 Pathogenesis-related thaumatin superfamily protein (.1.2)
AT4G38660 180 / 1e-54 Pathogenesis-related thaumatin superfamily protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G087100 394 / 3e-139 AT1G77700 384 / 2e-134 Pathogenesis-related thaumatin superfamily protein (.1)
Potri.003G020100 272 / 3e-91 AT1G77700 274 / 1e-90 Pathogenesis-related thaumatin superfamily protein (.1)
Potri.001G210400 270 / 2e-90 AT1G77700 273 / 1e-90 Pathogenesis-related thaumatin superfamily protein (.1)
Potri.014G040700 198 / 8e-63 AT1G75030 342 / 5e-120 thaumatin-like protein 3 (.1)
Potri.015G039200 195 / 2e-61 AT1G73620 352 / 1e-123 Pathogenesis-related thaumatin superfamily protein (.1)
Potri.005G112700 195 / 5e-61 AT4G36010 372 / 3e-130 Pathogenesis-related thaumatin superfamily protein (.1.2)
Potri.012G047800 192 / 1e-60 AT1G73620 379 / 3e-134 Pathogenesis-related thaumatin superfamily protein (.1)
Potri.005G112600 190 / 1e-58 AT4G38660 348 / 2e-119 Pathogenesis-related thaumatin superfamily protein (.1.2)
Potri.005G240900 189 / 3e-58 AT1G75800 398 / 7e-140 Pathogenesis-related thaumatin superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10025629 303 / 5e-102 AT1G77700 377 / 4e-130 Pathogenesis-related thaumatin superfamily protein (.1)
Lus10009058 200 / 2e-63 AT1G73620 376 / 2e-133 Pathogenesis-related thaumatin superfamily protein (.1)
Lus10032726 194 / 3e-61 AT1G75030 334 / 5e-117 thaumatin-like protein 3 (.1)
Lus10028448 192 / 7e-60 AT4G36010 332 / 9e-115 Pathogenesis-related thaumatin superfamily protein (.1.2)
Lus10028447 187 / 1e-57 AT4G38660 359 / 4e-124 Pathogenesis-related thaumatin superfamily protein (.1.2)
Lus10041901 187 / 1e-57 AT4G36010 329 / 2e-113 Pathogenesis-related thaumatin superfamily protein (.1.2)
Lus10017266 186 / 3e-57 AT4G24180 322 / 7e-111 THAUMATIN-LIKE PROTEIN 1 (.1)
Lus10013561 186 / 5e-57 AT4G38660 326 / 2e-112 Pathogenesis-related thaumatin superfamily protein (.1.2)
Lus10015705 180 / 9e-56 AT1G75030 256 / 6e-86 thaumatin-like protein 3 (.1)
Lus10037483 182 / 1e-55 AT1G75030 242 / 3e-79 thaumatin-like protein 3 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0293 CDC PF00314 Thaumatin Thaumatin family
Representative CDS sequence
>Potri.005G173900.1 pacid=42802997 polypeptide=Potri.005G173900.1.p locus=Potri.005G173900 ID=Potri.005G173900.1.v4.1 annot-version=v4.1
ATGGCACGTCTTAATCTGAATCTACTGCTGTTGCTGATTCTACTCGTGCTTTCATCAGGGCCAAAAATGATGGAGAGTCTGAGAGTCTTCACCATAACTA
ATTATTGCAAAGAAACGGTATGGCCGGGTATCTTCCCAGGTGAGAACTTCAATGGTGGTGGATTTGAGTTGAAACCAGGCCAATCTAGTGTTTTAAATGC
TCCGGTTGGCTGGAGTGGCCGGATATGGGGTAGAACAGGCTGTAGTTTTGACAAAAATGGGAACGGTACATGCAAGACTGGGACCTGTGGTTCATTCCTG
AAATGCAGGGCCTCAGGTGAAACCCCTGCCTCACTTGCTGAATTTACCCTAACAACACTCGACTTTTACGATGTTAGCCTTGTCGACGGGTTTAACTTGC
CGATAGCTGTTACGCCGATCAATGGTAAAGGAAATTGCAGTGTTGCTGGCTGTGATGCAGATTTGAGGGATACTTGCCCTTCAGAGCTGGCTGTTAAGTC
CAAGGGAAAGGTCATCGCTTGTCGAAGCGCTTGTGATGTGTTCAACACGGATGAATATTGTTGCAGGGGACTTTATGGAAACCCTAGGGTGTGCCAACCT
ACATTTTATTCAAAGAAGTTCAAAGAAGCTTGCCCCACTGCTTATAGCTATGCATATGATGATCCTACCAGTATTTGTACGTGCGCAGGAACAGATTATG
TCATCACCTTTTGCTCATCCAGGAAGCGAGAGGCTTGCACCTACCATAATAACAAGCTTATTTGCAGTGGATCAAGAGGCTTAAAATCACTGATTGAGAG
ATGGTGGGCTCTCGTTTTCGTATTGCCACTGTTACTTGCCTTCTGA
AA sequence
>Potri.005G173900.1 pacid=42802997 polypeptide=Potri.005G173900.1.p locus=Potri.005G173900 ID=Potri.005G173900.1.v4.1 annot-version=v4.1
MARLNLNLLLLLILLVLSSGPKMMESLRVFTITNYCKETVWPGIFPGENFNGGGFELKPGQSSVLNAPVGWSGRIWGRTGCSFDKNGNGTCKTGTCGSFL
KCRASGETPASLAEFTLTTLDFYDVSLVDGFNLPIAVTPINGKGNCSVAGCDADLRDTCPSELAVKSKGKVIACRSACDVFNTDEYCCRGLYGNPRVCQP
TFYSKKFKEACPTAYSYAYDDPTSICTCAGTDYVITFCSSRKREACTYHNNKLICSGSRGLKSLIERWWALVFVLPLLLAF

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G77700 Pathogenesis-related thaumatin... Potri.005G173900 0 1
AT2G18196 Heavy metal transport/detoxifi... Potri.011G149500 1.41 0.9499
AT2G35585 unknown protein Potri.010G101500 2.44 0.9494
AT3G01680 SEOR1, SEOb Sieve-Element-Occlusion-Relate... Potri.001G340600 5.83 0.9620
AT3G27030 unknown protein Potri.017G064500 6.48 0.9362
Potri.006G225400 6.92 0.9354
AT1G29380 Carbohydrate-binding X8 domain... Potri.011G078500 8.06 0.9455
AT3G30340 nodulin MtN21 /EamA-like trans... Potri.011G149000 8.60 0.9150
AT5G62350 Plant invertase/pectin methyle... Potri.012G127500 8.66 0.9272
AT1G79480 Carbohydrate-binding X8 domain... Potri.008G082900 9.79 0.9434
AT5G02140 Pathogenesis-related thaumatin... Potri.006G088100 12.80 0.9461

Potri.005G173900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.