Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G16810 121 / 3e-36 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G253400 [exp] 141 / 3e-44 AT1G16810 113 / 5e-33 unknown protein
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10033383 [exp] 139 / 2e-43 AT1G16810 136 / 4e-42 unknown protein Lus10034837 [exp] 138 / 6e-43 AT1G16810 133 / 7e-41 unknown protein Lus10026960 [exp] 138 / 6e-43 AT1G16810 110 / 7e-32 unknown protein
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF08555 [poplar] [flax] DUF1754 Eukaryotic family of unknown function (DUF1754)
Representative CDS sequence Show only first row Show all	>Potri.005G174400.1 pacid=42803430 polypeptide=Potri.005G174400.1.p locus=Potri.005G174400 ID=Potri.005G174400.1.v4.1 annot-version=v4.1 ATGTCTGCGTACGAGAACGTGATAGGGGGGAGGCTGAAGCTGAAGGGTAAAGCACTGGACGTGAAAGCAGGTGGCATTATCAAGAAGAAGAAGAATCTCC GTTACAAGAAGCATCGTTATCAAGATCAATCTGCAGCAGATGGAAATACAGCCTTAGCAACAGATCATGCTAGGGATATGAACGAGACAGACAAATGTGA TGAACAAGGGCAGACTGCAAAGTATGATGATCATCTTACACCAGCTGAGAAGCGATATCTCCAGCAGTGGGAGAAAATCGATACCCAAAGGATGGTTAAG ATGGCCAGCAAATCTCACCGTGATCGGATTCAGGAATTCAATCAATATCTGGCTAACCTAAGTGAGCATTATGACATTCCTAAGGTGGGGCCTGGTTAG
AA sequence Show only first row Show all	>Potri.005G174400.1 pacid=42803430 polypeptide=Potri.005G174400.1.p locus=Potri.005G174400 ID=Potri.005G174400.1.v4.1 annot-version=v4.1 MSAYENVIGGRLKLKGKALDVKAGGIIKKKKNLRYKKHRYQDQSAADGNTALATDHARDMNETDKCDEQGQTAKYDDHLTPAEKRYLQQWEKIDTQRMVK MASKSHRDRIQEFNQYLANLSEHYDIPKVGPG

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G16810			unknown protein		Potri.005G174400 [exp]	0	1
AT3G24500		MBF1C, ATMBF1C	multiprotein bridging factor 1...		Potri.018G075200 [exp]	1.00	0.9760
AT3G02300			Regulator of chromosome conden...		Potri.017G099900 [exp]	1.73	0.9585
AT2G32070			Polynucleotidyl transferase, r...		Potri.001G046700 [exp]	4.89	0.9451
AT3G10985		WI12, ATWI-12, ...	ARABIDOPSIS THALIANA WOUND-IND...		Potri.008G075200 [exp]	5.83	0.9376
					Potri.003G131550 [exp]	7.21	0.9670
AT3G14200			Chaperone DnaJ-domain superfam...		Potri.001G164700 [exp]	7.21	0.9140
AT3G24100			Uncharacterised protein family...		Potri.014G056600 [exp]	7.48	0.9134
AT5G63830			HIT-type Zinc finger family pr...		Potri.003G145100 [exp]	8.36	0.9426
AT5G41470			Nuclear transport factor 2 (NT...		Potri.003G131500 [exp]	9.74	0.9560
AT5G47830			unknown protein		Potri.014G024500 [exp]	9.89	0.9503

Compare expression of checked genes

Potri.005G174400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.