Plant FIBer expression Database

Potri.005G176466 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G157900
[exp]
41 / 6e-05 AT1G13740 229 / 1e-72 ABI five binding protein 2 (.1)
Flax homologues

No hit found
PFAM info
Representative CDS sequence
>Potri.005G176466.1 pacid=42802822 polypeptide=Potri.005G176466.1.p locus=Potri.005G176466 ID=Potri.005G176466.1.v4.1 annot-version=v4.1
ATGTTTTGCTTGATGTATTTTCGCTTCGATACGATTTCATCTTTTTCTCTCCGCAAACACAAAATCTCCATACCAAAAACCGGTAATCTTTTCAAGAAGC
TTGATTCTGCAGAAAACAGAGGGAGAGAAATTGGGACCAATTCCCTTGCTCAGAAGCTGATCCCAAGCCATCACCATGTTCGGATTTCTGCTTTATCTAC
TCTCCTTGAAGGTCCATCCAGTTTCGATCCCATAATCCATAACATGATGTGGATTTTCCCTGTAACAGAAGTCCATCATCCCTCGGCCATCGCTAAGCTC
GGAACCATGTTTGCCGAAGCCTGTCATTTTGCAACTATAAGAAAGCAATTGGAGGGTAATGAAATCCATGTTTTCTGGGTGAGTTGA
AA sequence
>Potri.005G176466.1 pacid=42802822 polypeptide=Potri.005G176466.1.p locus=Potri.005G176466 ID=Potri.005G176466.1.v4.1 annot-version=v4.1
MFCLMYFRFDTISSFSLRKHKISIPKTGNLFKKLDSAENRGREIGTNSLAQKLIPSHHHVRISALSTLLEGPSSFDPIIHNMMWIFPVTEVHHPSAIAKL
GTMFAEACHFATIRKQLEGNEIHVFWVS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.005G176466
[exp]
0 1
AT5G03990 unknown protein Potri.006G045900
[exp]
12.80 0.8955
AT4G37680 HHP4 heptahelical protein 4 (.1.2) Potri.007G005800
[exp]
17.14 0.8925
AT3G09925 Pollen Ole e 1 allergen and ex... Potri.006G119100
[exp]
24.49 0.8917
AT3G04500 RNA-binding (RRM/RBD/RNP motif... Potri.019G018900
[exp]
25.21 0.8799
AT3G24500 MBF1C, ATMBF1C multiprotein bridging factor 1... Potri.018G075200
[exp]
27.05 0.8843
Potri.014G081150
[exp]
27.34 0.7996
AT2G04100 MATE efflux family protein (.1... Potri.017G120500
[exp]
35.07 0.8840
AT3G10985 WI12, ATWI-12, ... ARABIDOPSIS THALIANA WOUND-IND... Potri.008G075200
[exp]
36.93 0.8675
AT3G02860 C2H2ZnF zinc ion binding (.1.2) Potri.017G135500
[exp]
38.79 0.8784
AT3G24130 Pectin lyase-like superfamily ... Potri.017G054700
[exp]
39.94 0.8746

Potri.005G176466 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.