Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G44760 226 / 3e-75 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT1G69080 108 / 4e-29 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) AT2G03720 100 / 9e-27 MRH6 morphogenesis of root hair 6, Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT5G17390 88 / 1e-20 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT3G03290 87 / 2e-20 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT4G13450 62 / 9e-12 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) AT3G20200 44 / 7e-05 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) AT3G13690 41 / 0.0005 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G084600 [exp] 345 / 5e-122 AT1G44760 200 / 5e-65 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.010G140200 [exp] 113 / 9e-31 AT1G69080 202 / 3e-65 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Potri.008G109000 [exp] 112 / 2e-30 AT1G69080 196 / 6e-63 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Potri.T170801 [exp] 110 / 9e-30 AT1G69080 196 / 3e-63 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Potri.015G060700 [exp] 95 / 1e-23 AT3G03290 198 / 2e-63 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.010G064800 [exp] 58 / 3e-10 AT4G13450 194 / 4e-63 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Potri.005G015200 [exp] 45 / 6e-06 AT3G62550 156 / 4e-49 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.013G009800 [exp] 43 / 4e-05 AT3G62550 172 / 2e-55 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10029664 [exp] 215 / 6e-71 AT1G44760 236 / 2e-79 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10042701 [exp] 202 / 5e-66 AT1G44760 235 / 6e-79 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10025644 [exp] 199 / 9e-65 AT1G44760 211 / 1e-69 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10018190 [exp] 182 / 9e-59 AT1G44760 197 / 1e-64 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10019173 [exp] 114 / 3e-31 AT1G69080 192 / 2e-61 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Lus10034661 [exp] 84 / 1e-19 AT5G17390 160 / 3e-48 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10007982 [exp] 76 / 2e-16 AT5G17390 149 / 1e-43 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10036814 [exp] 69 / 3e-15 AT1G69080 109 / 7e-32 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Lus10043152 [exp] 54 / 1e-08 AT4G13450 178 / 4e-56 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Lus10014459 [exp] 54 / 1e-08 AT4G13450 195 / 8e-63 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0039 [poplar] [flax] HUP PF00582 [poplar] [flax] Usp Universal stress protein family
Representative CDS sequence Show only first row Show all	>Potri.005G177100.1 pacid=42803030 polypeptide=Potri.005G177100.1.p locus=Potri.005G177100 ID=Potri.005G177100.1.v4.1 annot-version=v4.1 ATGCCAAGTTCAGGTTCTTTCCTACGGCAGCTAAGTGGGAGGTCAACATCTTGGAGGAGTGCTAGCAACAGCAAGTATTGCACTGTTGAAGGTGGCTATA ACTGTGAGAGAAGTTTGAAGCAAATGGAAGGGGCTTACATGTATGGTAATGACAATGCTGGGTTGGTTATGAGGAAAAGAGTGGTGGTGGTGGTGGATCA AACTTCACATTCTAAGCATGCAATGATGTGGGCATTGACTCATGTTGCTAACAAGGGTGATTTGCTCACTTTGCTTCACATTATCCCTCCTAGCGACATA GGCAGCGGTGAAAGAACATCTGATGCTTACTCTCCTTATCTTGCTAGTTCTCTTGGGTCACTTTGCAAGGCTAGCCGACCTGAGGTGGAAGTGGAAGCAC TGGTGATTCAAGGACCCAAGCTGGGCACGGTGATGAGCCAGGTGAAGAAGCTAGAGGCTTCTGTGCTCGTCCTGGGTCAGAAAAGGCCCTCTACACTTAT CAGCTGCCTCTGTGGGACAAGCAGCAGCGAAGATTTTGTTCAGCAGTGCATCAGCAATGCAGAATGCTTGACTGTCGGTGTAAGGAAGCAGAGCCAAGGC ATGAGCGGGTACCTCATCACCACTAGAAGGCAGAAGGACTTCTGGCTCCTTGCTTAG
AA sequence Show only first row Show all	>Potri.005G177100.1 pacid=42803030 polypeptide=Potri.005G177100.1.p locus=Potri.005G177100 ID=Potri.005G177100.1.v4.1 annot-version=v4.1 MPSSGSFLRQLSGRSTSWRSASNSKYCTVEGGYNCERSLKQMEGAYMYGNDNAGLVMRKRVVVVVDQTSHSKHAMMWALTHVANKGDLLTLLHIIPPSDI GSGERTSDAYSPYLASSLGSLCKASRPEVEVEALVIQGPKLGTVMSQVKKLEASVLVLGQKRPSTLISCLCGTSSSEDFVQQCISNAECLTVGVRKQSQG MSGYLITTRRQKDFWLLA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G44760			Adenine nucleotide alpha hydro...		Potri.005G177100 [exp]	0	1
AT1G05720			selenoprotein family protein (...		Potri.019G112100 [exp]	2.82	0.8917
AT2G33640			DHHC-type zinc finger family p...		Potri.005G254432 [exp]	4.58	0.8731
AT2G34560			P-loop containing nucleoside t...		Potri.004G065100 [exp]	7.00	0.8977
AT2G24800			Peroxidase superfamily protein...		Potri.018G015500 [exp]	10.58	0.8636
AT4G12910		SCPL20	serine carboxypeptidase-like 2...		Potri.014G177500 [exp]	11.87	0.8095
AT5G14430			S-adenosyl-L-methionine-depend...		Potri.001G342300 [exp]	12.00	0.8719
AT1G30800			Fasciclin-like arabinogalactan...		Potri.011G155150 [exp]	15.96	0.8626
AT5G61540			N-terminal nucleophile aminohy...		Potri.014G191900 [exp]	16.24	0.8762
AT2G26110			Protein of unknown function (D...		Potri.018G053000 [exp]	22.80	0.8369
					Potri.003G104800 [exp]	23.97	0.8762

Compare expression of checked genes

Potri.005G177100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.