Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G26430 154 / 1e-45 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) AT1G67830 142 / 5e-41 ATFXG1 Arabidopsis thaliana alpha-fucosidase 1, alpha-fucosidase 1 (.1) AT5G14450 125 / 2e-34 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) AT1G54790 118 / 7e-32 GDSL-like Lipase/Acylhydrolase superfamily protein (.1.2.3) AT4G01130 111 / 3e-29 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) AT3G27950 104 / 8e-27 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) AT3G05180 101 / 2e-25 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) AT1G09390 99 / 1e-24 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) AT1G56670 94 / 1e-22 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) AT3G62280 81 / 3e-18 GDSL-like Lipase/Acylhydrolase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G177700 [exp] 313 / 1e-107 AT3G26430 407 / 2e-141 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Potri.002G083700 [exp] 219 / 1e-70 AT3G26430 417 / 3e-145 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Potri.002G083800 [exp] 219 / 1e-70 AT3G26430 405 / 8e-141 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Potri.001G074400 [exp] 197 / 2e-62 AT3G26430 388 / 8e-134 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Potri.010G047900 [exp] 154 / 1e-45 AT3G26430 504 / 1e-179 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Potri.008G185500 [exp] 153 / 5e-45 AT3G26430 534 / 0.0 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Potri.005G038800 [exp] 134 / 7e-38 AT1G54790 595 / 0.0 GDSL-like Lipase/Acylhydrolase superfamily protein (.1.2.3) Potri.013G026300 [exp] 132 / 4e-37 AT1G54790 605 / 0.0 GDSL-like Lipase/Acylhydrolase superfamily protein (.1.2.3) Potri.001G342600 [exp] 126 / 6e-35 AT5G14450 595 / 0.0 GDSL-like Lipase/Acylhydrolase superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032094 [exp] 127 / 5e-35 AT5G14450 578 / 0.0 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Lus10014592 [exp] 126 / 5e-35 AT5G14450 573 / 0.0 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Lus10029980 [exp] 119 / 5e-32 AT1G54790 578 / 0.0 GDSL-like Lipase/Acylhydrolase superfamily protein (.1.2.3) Lus10029638 [exp] 114 / 4e-30 AT1G54790 443 / 2e-155 GDSL-like Lipase/Acylhydrolase superfamily protein (.1.2.3) Lus10029639 [exp] 113 / 6e-30 AT1G54790 421 / 4e-147 GDSL-like Lipase/Acylhydrolase superfamily protein (.1.2.3) Lus10006224 [exp] 102 / 2e-25 AT3G26430 342 / 5e-111 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Lus10008784 [exp] 99 / 8e-25 AT3G27950 391 / 2e-135 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Lus10012644 [exp] 97 / 1e-23 AT4G01130 494 / 1e-175 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Lus10001522 [exp] 85 / 2e-19 AT1G09390 459 / 3e-162 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Lus10003021 [exp] 81 / 3e-18 AT3G26430 385 / 4e-133 GDSL-like Lipase/Acylhydrolase superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.005G177900.2 pacid=42803021 polypeptide=Potri.005G177900.2.p locus=Potri.005G177900 ID=Potri.005G177900.2.v4.1 annot-version=v4.1 ATGACAAATATCTCTTCTTTTTGCCTTGTTTTTTTCACTTTACTTACCATCTTGAACCCCATATCTGCTTTGAAAAGTTGTGAGTTCCCAGCTATCTTTA ACTTTGGTGACTCAAATTCGGATACAGGAGGATTCGTTGCTTCCTTCCCTCCTCTTAATTCTTCTCCCTATGGAGAAACTTACTTTCAAATGCCGGCGGG GAGGTTCTCCGATGGAAGGCTGATTATAGATTTCGTCGCGCTTACCTCGACTCTCTGGGGACCAACTTCACTGTCGGAGCAAATTTATGCCACAGCATCA TCCACCAGTACATTGCCAGCTAGGATTATACCGGCCAATAATGGATTCAGTCCATTCTTCTTTCTAGTGCAATATAATCAATTCGTGCAGTTGAAGGCCA GATCACAGTTGATTAGGAAACAAGGAGGAGTATTTGCACGATTGATCCCCAAGGAGGAATATTTTCAAAAAGCTTTATACACATTCGATATTGGTCAGAA TGATCTTGGAGCTGGATTTTTCGGAAATATGTCTGTCGAGAGGAAGTCAATACGTTCTTGA
AA sequence Show only first row Show all	>Potri.005G177900.2 pacid=42803021 polypeptide=Potri.005G177900.2.p locus=Potri.005G177900 ID=Potri.005G177900.2.v4.1 annot-version=v4.1 MTNISSFCLVFFTLLTILNPISALKSCEFPAIFNFGDSNSDTGGFVASFPPLNSSPYGETYFQMPAGRFSDGRLIIDFVALTSTLWGPTSLSEQIYATAS STSTLPARIIPANNGFSPFFFLVQYNQFVQLKARSQLIRKQGGVFARLIPKEEYFQKALYTFDIGQNDLGAGFFGNMSVERKSIRS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G26430			GDSL-like Lipase/Acylhydrolase...		Potri.005G177900 [exp]	0	1
AT4G33090		ATAPM1, APM1	aminopeptidase M1 (.1)		Potri.017G039200 [exp]	1.41	0.9588
AT4G32300		SD2-5	S-domain-2 5 (.1)		Potri.004G014301 [exp]	4.69	0.9521
AT4G00330		CRCK2	calmodulin-binding receptor-li...		Potri.002G161600 [exp]	8.00	0.9358
AT5G23670		ATLCB2, LCB2	long chain base2 (.1.2)		Potri.015G103800 [exp]	8.71	0.9401	LJLCB2.1
AT2G46420			Plant protein 1589 of unknown ...		Potri.002G169900 [exp]	10.24	0.9387
					Potri.003G088201 [exp]	13.11	0.9241
AT4G23200		CRK12	cysteine-rich RLK (RECEPTOR-li...		Potri.018G111700 [exp]	13.78	0.9399
AT1G13940			Plant protein of unknown funct...		Potri.006G262600 [exp]	14.07	0.9380
					Potri.012G120584 [exp]	14.69	0.9308
AT1G07230		NPC1	non-specific phospholipase C1 ...		Potri.001G250500 [exp]	14.69	0.9436

Compare expression of checked genes

Potri.005G177900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.