Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G63420 81 / 3e-21 AGG1, ATAGG1 Ggamma-subunit 1 (.1.2) AT3G22942 73 / 5e-18 AtGG2, AGG2 G-protein gamma subunit 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G081500 [exp] 197 / 1e-66 AT3G63420 62 / 1e-13 Ggamma-subunit 1 (.1.2) Potri.015G142500 [exp] 88 / 1e-23 AT3G22942 100 / 4e-29 G-protein gamma subunit 2 (.1) Potri.002G046900 [exp] 73 / 8e-18 AT3G63420 102 / 1e-29 Ggamma-subunit 1 (.1.2) Potri.005G216100 [exp] 71 / 1e-16 AT3G63420 103 / 4e-30 Ggamma-subunit 1 (.1.2) Potri.018G062400 [exp] 42 / 3e-05 AT5G20635 112 / 3e-30 Arabidopsis G protein gamma subunit 3, unknown protein Potri.006G141100 [exp] 41 / 5e-05 AT5G20635 120 / 2e-33 Arabidopsis G protein gamma subunit 3, unknown protein
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10029687 [exp] 114 / 2e-33 AT3G63420 69 / 4e-16 Ggamma-subunit 1 (.1.2) Lus10042727 [exp] 112 / 8e-33 AT3G63420 70 / 3e-16 Ggamma-subunit 1 (.1.2) Lus10014714 [exp] 83 / 1e-21 AT3G63420 104 / 2e-30 Ggamma-subunit 1 (.1.2) Lus10003092 [exp] 81 / 1e-20 AT3G63420 103 / 2e-30 Ggamma-subunit 1 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00631 [poplar] [flax] G-gamma GGL domain
Representative CDS sequence Show only first row Show all	>Potri.005G179600.1 pacid=42802881 polypeptide=Potri.005G179600.1.p locus=Potri.005G179600 ID=Potri.005G179600.1.v4.1 annot-version=v4.1 ATGGAATCAGATTCAATAGAAATGGACGGGCAACATTCGGTGTCTTCGCTTGAAGAACCAAAAAGGGAGGAGTCAGTAGTGGCAGAAACATCAAGTTTTA TTCCAAGAACAAGGCCTAACAACTTCCTGAGTAAGCATCGAATGGTAGCTGCAATCACCCAACTTCAGAATCAAATCAATTTCATACAGGAGGAGCTGGA CCAGCTTGATACATTAGGGGAATCGTCAATTGTTTGCGAAGAACTCCTGTCAAGTGTTGAATCGATTCCTGACCCACTACTTCCATCGACTCAAGGTCCG GTAAACGCTAGCTGGGATCGGTGGTTCAAAGGGAACCAGAACTCGCGAAGACGGTGGATCTAA
AA sequence Show only first row Show all	>Potri.005G179600.1 pacid=42802881 polypeptide=Potri.005G179600.1.p locus=Potri.005G179600 ID=Potri.005G179600.1.v4.1 annot-version=v4.1 MESDSIEMDGQHSVSSLEEPKREESVVAETSSFIPRTRPNNFLSKHRMVAAITQLQNQINFIQEELDQLDTLGESSIVCEELLSSVESIPDPLLPSTQGP VNASWDRWFKGNQNSRRRWI

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G63420		AGG1, ATAGG1	Ggamma-subunit 1 (.1.2)		Potri.005G179600 [exp]	0	1
AT3G47620	TCP	AtTCP14, TCP14	"TEOSINTE BRANCHED, cycloidea ...		Potri.004G046300 [exp]	1.41	0.8857
AT3G61180			RING/U-box superfamily protein...		Potri.002G155200 [exp]	2.82	0.8783
AT3G52950			CBS / octicosapeptide/Phox/Bem...		Potri.007G098400 [exp]	2.82	0.8540
AT5G66090			unknown protein		Potri.005G109100 [exp]	4.47	0.8954
AT4G39400		DWF2, CBB2, BIN...	DWARF 2, CABBAGE 2, BRASSINOST...		Potri.007G078100 [exp]	7.48	0.8559	Pt-BRI1.2
AT2G15580			RING/U-box superfamily protein...		Potri.018G114500 [exp]	9.64	0.8815
AT1G21830			unknown protein		Potri.005G177600 [exp]	12.48	0.8357
AT1G55020		ATLOX1, LOX1	ARABIDOPSIS LIPOXYGENASE 1, li...		Potri.013G022000 [exp]	16.73	0.8400	Pt-LOX1.6
AT2G39170			unknown protein		Potri.010G227400 [exp]	16.97	0.8199
AT2G20570	GARP	ATGLK1, GLK1, G...	ARABIDOPSIS GOLDEN2-LIKE 1, GB...		Potri.017G015800 [exp]	22.44	0.8467

Compare expression of checked genes

Potri.005G179600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.