Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G77470 0 / 1 EMB2810, RFC5, RFC3 replication factor C 5, EMBRYO DEFECTIVE 2810, replication factor C subunit 3 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G081200 [exp] 111 / 5e-30 AT1G77470 577 / 0.0 replication factor C 5, EMBRYO DEFECTIVE 2810, replication factor C subunit 3 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018144 [exp] 99 / 3e-25 AT1G77470 564 / 0.0 replication factor C 5, EMBRYO DEFECTIVE 2810, replication factor C subunit 3 (.1) Lus10025689 [exp] 99 / 4e-25 AT1G77470 568 / 0.0 replication factor C 5, EMBRYO DEFECTIVE 2810, replication factor C subunit 3 (.1) Lus10029690 [exp] 47 / 6e-07 AT1G77460 183 / 1e-53 Armadillo/beta-catenin-like repeat ; C2 calcium/lipid-binding domain (CaLB) protein (.1), Armadillo/beta-catenin-like repeat ; C2 calcium/lipid-binding domain (CaLB) protein (.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0604 [poplar] [flax] post-AAA PF08542 [poplar] [flax] Rep_fac_C Replication factor C C-terminal domain
Representative CDS sequence Show only first row Show all	>Potri.005G180001.1 pacid=42804834 polypeptide=Potri.005G180001.1.p locus=Potri.005G180001 ID=Potri.005G180001.1.v4.1 annot-version=v4.1 ATGCTTGACTGTAAGAGTGCGAGAAAAGAAACTCAATCAAAAAGGCAAAGAGAGCTGAAAGCCTACTATAATCCCTACCAAGGCCAAGGGCTGTGGCCCA GTCCCTCTTGCCTGCCTTGTCAACACAAATGGCTTCCCAGCAAATTACAGAAGAAGCTGTATACACGTGCACTGGAAACCCATTGCCCAAAGACATTGAG AATTTTTGAAATCAAGACAAGGAAAGGTTTGGCCTTGGTGGATATCGTCAGAGAAGTGACCACTTGTTATTCCAACAGGTTTGTTTTCCAGATTAAGATG AAATCAGATGTCCGAGTGCCATTGATCAATGATTTGGCTGATATAGAATACAGGTTGGTCTTTGGGTGCAATGATAAGTTGCATCTCGGATCACTTATCG CTTCTTTTGCAAGGGCTCGATCTGCTTTGGTTGCAGCAGCAAGTTAG
AA sequence Show only first row Show all	>Potri.005G180001.1 pacid=42804834 polypeptide=Potri.005G180001.1.p locus=Potri.005G180001 ID=Potri.005G180001.1.v4.1 annot-version=v4.1 MLDCKSARKETQSKRQRELKAYYNPYQGQGLWPSPSCLPCQHKWLPSKLQKKLYTRALETHCPKTLRIFEIKTRKGLALVDIVREVTTCYSNRFVFQIKM KSDVRVPLINDLADIEYRLVFGCNDKLHLGSLIASFARARSALVAAAS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G77470		EMB2810, RFC5, ...	replication factor C 5, EMBRYO...		Potri.005G180001 [exp]	0	1
AT1G18330	MYB	RVE7, EPR1	REVEILLE 7, EARLY-PHYTOCHROME-...		Potri.012G038300 [exp]	1.73	0.7497	Pt-EPR1.2
AT5G52880			F-box family protein (.1)		Potri.012G035500 [exp]	36.83	0.7097
AT1G55170			unknown protein		Potri.003G037900 [exp]	52.99	0.7042
					Potri.008G176201 [exp]	54.69	0.7344
AT3G28970		AAR3	antiauxin-resistant 3, Domain ...		Potri.004G122100 [exp]	74.29	0.7163
AT4G24290			MAC/Perforin domain-containing...		Potri.003G006500 [exp]	95.33	0.7088
AT3G02010			Pentatricopeptide repeat (PPR)...		Potri.014G145550 [exp]	129.07	0.7045
AT3G14750			unknown protein		Potri.001G382700 [exp]	131.90	0.6808
AT2G35900			unknown protein		Potri.016G066800 [exp]	136.50	0.6516
AT4G27220			NB-ARC domain-containing disea...		Potri.011G124100 [exp]	167.92	0.6905

Compare expression of checked genes

Potri.005G180001 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.