Pt-PBC2.1 (Potri.005G180500) [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol Pt-PBC2.1
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G21720 391 / 6e-141 PBC1 proteasome beta subunit C1 (.1)
AT1G77440 386 / 7e-139 PBC2 20S proteasome beta subunit C2 (.1.2)
AT3G60820 87 / 5e-21 PBF1 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G080800 410 / 2e-148 AT1G21720 383 / 1e-137 proteasome beta subunit C1 (.1)
Potri.002G148300 87 / 4e-21 AT3G60820 387 / 2e-138 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3)
Potri.014G069800 86 / 1e-20 AT3G60820 362 / 6e-129 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10020599 356 / 5e-127 AT1G21720 355 / 7e-127 proteasome beta subunit C1 (.1)
Lus10004885 356 / 5e-127 AT1G21720 356 / 2e-127 proteasome beta subunit C1 (.1)
Lus10015867 96 / 4e-24 AT3G60820 379 / 2e-135 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3)
Lus10009294 76 / 7e-16 AT1G48050 835 / 0.0 ARABIDOPSIS THALIANA KU80 HOMOLOG, Ku80 family protein (.1)
Lus10000062 45 / 3e-06 AT3G60820 232 / 6e-79 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0052 NTN PF00227 Proteasome Proteasome subunit
Representative CDS sequence
>Potri.005G180500.1 pacid=42805577 polypeptide=Potri.005G180500.1.p locus=Potri.005G180500 ID=Potri.005G180500.1.v4.1 annot-version=v4.1
ATGTCGATCTTCGAGTACAATGGAAGTGCCATAGTTGCTATGGTGGGAAAGAACTGCTTCGCTATAGCTAGCGATCGCCGACTTGGAGTCAACCTTCAAA
CAGTCGCCACTGATTTCCAGCGAATCTACAAAATCCACGATAAGGTCTTCGTCGGTCTCTCTGGCCTTGGCACTGACGCCCAAACACTGTACCAGAGGCT
TGTTTTCCGTCACAAACTGTACCAGCTGCGAGAAGAAAGGGACATGAAGCCTGAGACTTTTGCCAGCCTTGTTTCTGCTATACTATATGAGAAAAGGTTT
GGTCCGTATTTCTGCCAGCCTGTCATTGCTGGATTGGGTGATGATGACAAGCCATTCATCTGCACAATGGATTTCATTGGGGCCAAGGAACTTGCAAAAG
ATTTTGTTGTTGCCGGCTCAGCCTCTGAGTCACTTTATGGTGCCTGTGAAGCATTGTTCAAGCCTGACATGGAACCTGAGGAATTATTTGAAGTTGTGTC
CCAAGCATTACTAGCATCAGTAGATCGGGACTGCTTGAGTGGTTGGGGAGGACACATCTATATTGTCACCCCTGATGAAATTAGAGAGAAAATCCTAAAG
GGAAGGATGGATTGA
AA sequence
>Potri.005G180500.1 pacid=42805577 polypeptide=Potri.005G180500.1.p locus=Potri.005G180500 ID=Potri.005G180500.1.v4.1 annot-version=v4.1
MSIFEYNGSAIVAMVGKNCFAIASDRRLGVNLQTVATDFQRIYKIHDKVFVGLSGLGTDAQTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRF
GPYFCQPVIAGLGDDDKPFICTMDFIGAKELAKDFVVAGSASESLYGACEALFKPDMEPEELFEVVSQALLASVDRDCLSGWGGHIYIVTPDEIREKILK
GRMD

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G21720 PBC1 proteasome beta subunit C1 (.1... Potri.005G180500 0 1 Pt-PBC2.1
AT3G22630 PRCGB, PBD1 20S proteasome beta subunit D1... Potri.008G155500 1.00 0.9205 Pt-PBD2.3
AT2G20820 unknown protein Potri.019G109100 2.82 0.9203
AT1G67250 Proteasome maturation factor U... Potri.006G249600 4.00 0.8937
AT5G42790 ARS5, ATPSM30, ... ARSENIC TOLERANCE 5, proteasom... Potri.005G229200 6.92 0.8985
AT1G53750 RPT1A regulatory particle triple-A 1... Potri.006G216600 9.53 0.8702 RPT1.5
AT5G48580 FKBP15-2 FK506- and rapamycin-binding p... Potri.002G248200 10.39 0.9031
AT1G02280 PPI1, ATTOC33, ... PLASTID PROTEIN IMPORT 1, tran... Potri.014G109400 15.29 0.8215
AT2G20820 unknown protein Potri.013G146000 15.29 0.8961
AT3G51260 PAD1 20S proteasome alpha subunit ... Potri.004G174200 15.65 0.8483 Pt-PAD1.2
AT2G20930 SNARE-like superfamily protein... Potri.009G136800 16.06 0.8413

Potri.005G180500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.