Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G21550 137 / 8e-42 Calcium-binding EF-hand family protein (.1) AT4G20780 99 / 2e-26 CML42 calmodulin like 42 (.1) AT1G05990 91 / 1e-23 RHS1 ,RHS2 ROOT HAIR SPECIFIC 1, EF hand calcium-binding protein family (.1) AT2G43290 89 / 1e-22 MSS3 multicopy suppressors of snf4 deficiency in yeast 3, Calcium-binding EF-hand family protein (.1) AT3G07490 88 / 2e-22 AtCML3, AGD11 calmodulin-like 3, ARF-GAP domain 11 (.1) AT3G59440 86 / 3e-21 Calcium-binding EF-hand family protein (.1) AT5G44460 84 / 7e-21 CML43 calmodulin like 43 (.1) AT4G03290 84 / 8e-21 EF hand calcium-binding protein family (.1) AT4G12860 82 / 3e-20 UNE14 unfertilized embryo sac 14, EF hand calcium-binding protein family (.1) AT1G24620 77 / 6e-18 EF hand calcium-binding protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G077300 [exp] 265 / 3e-92 AT1G21550 123 / 3e-36 Calcium-binding EF-hand family protein (.1) Potri.017G029700 [exp] 102 / 2e-27 AT3G07490 192 / 1e-62 calmodulin-like 3, ARF-GAP domain 11 (.1) Potri.007G128600 [exp] 101 / 3e-27 AT2G43290 218 / 3e-72 multicopy suppressors of snf4 deficiency in yeast 3, Calcium-binding EF-hand family protein (.1) Potri.006G112500 [exp] 88 / 3e-22 AT4G20780 238 / 2e-80 calmodulin like 42 (.1) Potri.002G239100 [exp] 85 / 3e-21 AT3G07490 248 / 8e-86 calmodulin-like 3, ARF-GAP domain 11 (.1) Potri.016G142000 [exp] 86 / 4e-21 AT4G20780 197 / 3e-64 calmodulin like 42 (.1) Potri.006G065900 [exp] 85 / 2e-20 AT3G07490 131 / 1e-38 calmodulin-like 3, ARF-GAP domain 11 (.1) Potri.005G259900 [exp] 77 / 9e-18 AT1G76650 156 / 2e-48 calmodulin-like 38 (.1.2.3) Potri.018G127100 [exp] 77 / 1e-17 AT3G07490 132 / 6e-39 calmodulin-like 3, ARF-GAP domain 11 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10000972 [exp] 170 / 2e-54 AT1G21550 128 / 3e-38 Calcium-binding EF-hand family protein (.1) Lus10028657 [exp] 162 / 3e-51 AT1G21550 122 / 9e-36 Calcium-binding EF-hand family protein (.1) Lus10042762 [exp] 122 / 1e-32 AT1G77260 741 / 0.0 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1) Lus10003239 [exp] 99 / 3e-26 AT4G20780 249 / 5e-85 calmodulin like 42 (.1) Lus10021134 [exp] 99 / 4e-26 AT4G20780 236 / 8e-80 calmodulin like 42 (.1) Lus10042761 [exp] 97 / 6e-26 AT1G21550 70 / 7e-16 Calcium-binding EF-hand family protein (.1) Lus10017174 [exp] 96 / 3e-25 AT4G20780 234 / 4e-79 calmodulin like 42 (.1) Lus10029730 [exp] 91 / 2e-24 AT1G21550 68 / 8e-16 Calcium-binding EF-hand family protein (.1) Lus10035611 [exp] 92 / 1e-23 AT4G20780 242 / 3e-82 calmodulin like 42 (.1) Lus10027701 [exp] 92 / 2e-23 AT2G43290 153 / 2e-46 multicopy suppressors of snf4 deficiency in yeast 3, Calcium-binding EF-hand family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0220 [poplar] [flax] EF_hand PF13202 [poplar] [flax] EF-hand_5 EF hand CL0220 [poplar] [flax] EF_hand PF13499 [poplar] [flax] EF-hand_7 EF-hand domain pair
Representative CDS sequence Show only first row Show all	>Potri.005G183300.1 pacid=42803472 polypeptide=Potri.005G183300.1.p locus=Potri.005G183300 ID=Potri.005G183300.1.v4.1 annot-version=v4.1 ATGTGTCTCCTTAAAACAAATGACTTGCACCGGATTTTCCAAGAACTTGACAGAAATGGTGATGGTCTCTTGAGTGCAGTGGAGCTTAATTGGCTTCTTG AAAGCATCGGAGGAGTCCATTTTAGCCTGGAGGAGCTTGAGTCTTCGGTGGGGAAGTCATGCCTCAACTTTGATGAGTTCTTGTTATTCTACGACTCCAT AACAAAGCAAAGCGGTGGCGGAAACAGCGAGGCAGTAGTAGCAGATGATCAGGAGGGCTGCAACAGGGAGGACTGTGACCTTGTTAAGGCATTTCAGGTG TTTGATTCTAACGGCGACGGATTCATTTCTATCGAGGAGCTTCAAAGCATGCTGTCAAGACTTGGATTATGGGATGAGACGACTGGCAAGGATTGTAGAA GTATGATTTGTAGATATGATACGAACTTAGATGGGGTTCTTGATTTTGAGGAATTCAAGAAGATGATGCTTCATACCAGTTCTTAA
AA sequence Show only first row Show all	>Potri.005G183300.1 pacid=42803472 polypeptide=Potri.005G183300.1.p locus=Potri.005G183300 ID=Potri.005G183300.1.v4.1 annot-version=v4.1 MCLLKTNDLHRIFQELDRNGDGLLSAVELNWLLESIGGVHFSLEELESSVGKSCLNFDEFLLFYDSITKQSGGGNSEAVVADDQEGCNREDCDLVKAFQV FDSNGDGFISIEELQSMLSRLGLWDETTGKDCRSMICRYDTNLDGVLDFEEFKKMMLHTSS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G21550			Calcium-binding EF-hand family...		Potri.005G183300 [exp]	0	1
AT5G14930		GENE101, SAG101	senescence-associated gene 101...		Potri.019G007227 [exp]	1.00	0.9758
AT3G53150		UGT73D1	UDP-glucosyl transferase 73D1 ...		Potri.006G120600 [exp]	1.73	0.9742	GT4.2
					Potri.008G019250 [exp]	2.00	0.9755
AT4G23180		RLK4, CRK10	cysteine-rich RLK (RECEPTOR-li...		Potri.004G024404 [exp]	2.64	0.9622
AT1G75280			NmrA-like negative transcripti...		Potri.007G123700 [exp]	3.16	0.9490	PCBERp2
					Potri.019G017304 [exp]	5.00	0.9684
AT4G37290			unknown protein		Potri.005G142900 [exp]	5.65	0.9732
AT4G37290			unknown protein		Potri.007G049500 [exp]	6.00	0.9586
AT5G65380			MATE efflux family protein (.1...		Potri.002G102100 [exp]	7.21	0.9304
AT1G68620			alpha/beta-Hydrolases superfam...		Potri.001G032400 [exp]	7.34	0.9213

Compare expression of checked genes

Potri.005G183300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.