Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G54160 127 / 6e-37 ATOMT1 O-methyltransferase 1 (.1) AT1G77520 87 / 2e-21 O-methyltransferase family protein (.1) AT1G63140 80 / 3e-19 O-methyltransferase family protein (.1.2) AT1G51990 81 / 4e-19 O-methyltransferase family protein (.1.2) AT1G21120 81 / 4e-19 IGMT2 indole glucosinolate O-methyltransferase 2, O-methyltransferase family protein (.1) AT1G21130 80 / 4e-19 IGMT4 indole glucosinolate O-methyltransferase 4, O-methyltransferase family protein (.1.2) AT1G21100 80 / 5e-19 IGMT1 indole glucosinolate O-methyltransferase 1, O-methyltransferase family protein (.1) AT1G21110 79 / 9e-19 IGMT3 indole glucosinolate O-methyltransferase 3, O-methyltransferase family protein (.1) AT5G53810 76 / 2e-17 O-methyltransferase family protein (.1) AT1G77530 70 / 2e-15 O-methyltransferase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G003100 [exp] 125 / 4e-36 AT5G54160 583 / 0.0 O-methyltransferase 1 (.1) Potri.012G006400 [exp] 120 / 5e-34 AT5G54160 605 / 0.0 O-methyltransferase 1 (.1) Potri.014G106600 [exp] 99 / 6e-26 AT5G54160 416 / 3e-145 O-methyltransferase 1 (.1) Potri.002G180433 [exp] 94 / 6e-24 AT5G54160 412 / 4e-144 O-methyltransferase 1 (.1) Potri.002G180466 [exp] 93 / 6e-24 AT5G54160 412 / 6e-144 O-methyltransferase 1 (.1) Potri.002G180500 [exp] 93 / 6e-24 AT5G54160 412 / 6e-144 O-methyltransferase 1 (.1) Potri.002G180600 [exp] 93 / 6e-24 AT5G54160 413 / 2e-144 O-methyltransferase 1 (.1) Potri.002G180700 [exp] 91 / 3e-23 AT5G54160 393 / 8e-137 O-methyltransferase 1 (.1) Potri.014G106500 [exp] 89 / 3e-22 AT5G54160 349 / 8e-119 O-methyltransferase 1 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015576 [exp] 120 / 7e-34 AT5G54160 595 / 0.0 O-methyltransferase 1 (.1) Lus10032929 [exp] 120 / 7e-34 AT5G54160 601 / 0.0 O-methyltransferase 1 (.1) Lus10002669 [exp] 107 / 5e-29 AT5G54160 376 / 5e-130 O-methyltransferase 1 (.1) Lus10005133 [exp] 106 / 1e-28 AT5G54160 381 / 1e-131 O-methyltransferase 1 (.1) Lus10006146 [exp] 103 / 2e-27 AT5G54160 338 / 5e-115 O-methyltransferase 1 (.1) Lus10002667 [exp] 99 / 6e-26 AT5G54160 368 / 1e-126 O-methyltransferase 1 (.1) Lus10030188 [exp] 81 / 6e-20 AT5G54160 213 / 9e-68 O-methyltransferase 1 (.1) Lus10014400 [exp] 51 / 2e-08 AT3G53140 562 / 0.0 O-methyltransferase family protein (.1) Lus10023987 [exp] 50 / 5e-08 AT4G35160 325 / 3e-109 O-methyltransferase family protein (.1) Lus10023892 [exp] 49 / 5e-08 AT3G53140 560 / 0.0 O-methyltransferase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0063 [poplar] [flax] NADP_Rossmann PF00891 [poplar] [flax] Methyltransf_2 O-methyltransferase domain
Representative CDS sequence Show only first row Show all	>Potri.005G183800.2 pacid=42803596 polypeptide=Potri.005G183800.2.p locus=Potri.005G183800 ID=Potri.005G183800.2.v4.1 annot-version=v4.1 ATGAGGTACCACTTTAATGATGCTATACTTGAAGGGGGCGTTCCATTCAACAGAGCTTATGGAATGACAGCTTTCCAGTATCCAGGCACTGACCATAGGT TCAATAGGGTATTCAATCAAGCGATGCCAAACCACACTCCCTTCATCATGAAGAAAATCCTTGATATTTACGAAGGGGTCGATGGGCTCGAGGTGTTAGT TGATGTTGGAGGTGGAATTGGAGATACTCTCAACATTATCACTTCCAAGTATCCTCACATTGAGGGCATAAATTATGATATGCCCCATGTATTAGCAGAT GCACCTTCGTAG
AA sequence Show only first row Show all	>Potri.005G183800.2 pacid=42803596 polypeptide=Potri.005G183800.2.p locus=Potri.005G183800 ID=Potri.005G183800.2.v4.1 annot-version=v4.1 MRYHFNDAILEGGVPFNRAYGMTAFQYPGTDHRFNRVFNQAMPNHTPFIMKKILDIYEGVDGLEVLVDVGGGIGDTLNIITSKYPHIEGINYDMPHVLAD APS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G54160		ATOMT1	O-methyltransferase 1 (.1)		Potri.005G183800 [exp]	0	1
AT5G05670			signal recognition particle bi...		Potri.009G001600 [exp]	1.41	0.8741
AT3G06560		PAPS3	poly(A) polymerase 3 (.1)		Potri.008G102500 [exp]	6.32	0.8125
AT1G72050	C2H2ZnF	TFIIIA	transcription factor IIIA (.1....		Potri.013G108600 [exp]	7.21	0.8248
AT3G19180		ATCDP1, ARC6H, ...	A. THALIANA CHLOROPLAST DIVISI...		Potri.012G036100 [exp]	12.96	0.7632
AT3G53270			Small nuclear RNA activating c...		Potri.004G126760 [exp]	14.00	0.8101
					Potri.003G025032 [exp]	14.69	0.7643
AT1G77230			Tetratricopeptide repeat (TPR)...		Potri.005G184001 [exp]	18.43	0.7974
AT5G11070			unknown protein		Potri.003G048200 [exp]	22.60	0.7167
AT4G07950			DNA-directed RNA polymerase, s...		Potri.012G015900 [exp]	23.45	0.7928
AT1G12740		CYP87A2	"cytochrome P450, family 87, s...		Potri.002G010532 [exp]	23.97	0.7696

Compare expression of checked genes

Potri.005G183800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.