Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G28720 50 / 2e-08 YUC8 YUCCA 8, Flavin-binding monooxygenase family protein (.1) AT1G21430 47 / 3e-07 YUC11 Flavin-binding monooxygenase family protein (.1) AT1G48910 45 / 9e-07 YUC10 YUCCA 10, Flavin-containing monooxygenase family protein (.1) AT4G32540 45 / 1e-06 YUC1, YUC YUCCA 1, YUCCA, Flavin-binding monooxygenase family protein (.1) AT1G04180 45 / 2e-06 YUC9 YUCCA 9 (.1) AT1G04610 45 / 2e-06 YUC3 YUCCA 3 (.1) AT5G25620 42 / 2e-05 YUC6 YUCCA6, Flavin-binding monooxygenase family protein (.1.2) AT4G13260 41 / 3e-05 YUC2 YUCCA2, Flavin-binding monooxygenase family protein (.1) AT2G33230 39 / 0.0001 YUC7 YUCCA 7 (.1) AT5G11320 39 / 0.0002 YUC4 YUCCA4, Flavin-binding monooxygenase family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G003300 [exp] 88 / 6e-22 AT1G21430 436 / 7e-153 Flavin-binding monooxygenase family protein (.1) Potri.005G111800 [exp] 75 / 3e-17 AT1G21430 425 / 4e-148 Flavin-binding monooxygenase family protein (.1) Potri.005G186100 [exp] 73 / 1e-16 AT1G21430 448 / 2e-157 Flavin-binding monooxygenase family protein (.1) Potri.002G207400 [exp] 52 / 4e-09 AT1G48910 429 / 3e-150 YUCCA 10, Flavin-containing monooxygenase family protein (.1) Potri.008G174600 [exp] 50 / 3e-08 AT1G04610 686 / 0.0 YUCCA 3 (.1) Potri.010G062400 [exp] 48 / 1e-07 AT1G04610 657 / 0.0 YUCCA 3 (.1) Potri.002G254200 [exp] 47 / 3e-07 AT4G28720 694 / 0.0 YUCCA 8, Flavin-binding monooxygenase family protein (.1) Potri.018G036800 [exp] 45 / 9e-07 AT5G25620 576 / 0.0 YUCCA6, Flavin-binding monooxygenase family protein (.1.2) Potri.006G243400 [exp] 45 / 1e-06 AT5G25620 608 / 0.0 YUCCA6, Flavin-binding monooxygenase family protein (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10043144 [exp] 47 / 2e-07 AT1G04610 284 / 1e-95 YUCCA 3 (.1) Lus10007671 [exp] 47 / 3e-07 AT4G13260 518 / 0.0 YUCCA2, Flavin-binding monooxygenase family protein (.1) Lus10043142 [exp] 45 / 1e-06 AT1G04610 599 / 0.0 YUCCA 3 (.1) Lus10000494 [exp] 45 / 2e-06 AT4G28720 318 / 2e-108 YUCCA 8, Flavin-binding monooxygenase family protein (.1) Lus10002402 [exp] 45 / 2e-06 AT1G21430 427 / 5e-149 Flavin-binding monooxygenase family protein (.1) Lus10013125 [exp] 45 / 2e-06 AT5G11320 579 / 0.0 YUCCA4, Flavin-binding monooxygenase family protein (.1.2) Lus10008092 [exp] 44 / 3e-06 AT5G11320 575 / 0.0 YUCCA4, Flavin-binding monooxygenase family protein (.1.2) Lus10011274 [exp] 44 / 4e-06 AT4G28720 643 / 0.0 YUCCA 8, Flavin-binding monooxygenase family protein (.1) Lus10022851 [exp] 43 / 7e-06 AT4G28720 666 / 0.0 YUCCA 8, Flavin-binding monooxygenase family protein (.1) Lus10035244 [exp] 41 / 3e-05 AT1G04610 692 / 0.0 YUCCA 3 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.005G186150.1 pacid=42805283 polypeptide=Potri.005G186150.1.p locus=Potri.005G186150 ID=Potri.005G186150.1.v4.1 annot-version=v4.1 ATGGGAGTAGAAGAGGGTCCTTTTTTCTTAAAACAACGAAAGGTCGATCTCCCACTATCGATGTTGGGTGCGTGGACAAAATTAAGCAAGGAAAGATCAA GGTCTTTCCATCCATTTCCATCCATAGCCAACATAGAAGGGAAGAAAATCGAATTTATGAATGGCGAGAGCAATCAATTTGACGCCATTATCTTTGCCAC TGGCTACAGAAGCACTGTGGGGAGAGGCTTAAGGTGTGCAGAATTTTTATGCTCAACTTTTATTGCATTAATTTGTTTAGCACGTACGTAG
AA sequence Show only first row Show all	>Potri.005G186150.1 pacid=42805283 polypeptide=Potri.005G186150.1.p locus=Potri.005G186150 ID=Potri.005G186150.1.v4.1 annot-version=v4.1 MGVEEGPFFLKQRKVDLPLSMLGAWTKLSKERSRSFHPFPSIANIEGKKIEFMNGESNQFDAIIFATGYRSTVGRGLRCAEFLCSTFIALICLART

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G21430		YUC11	Flavin-binding monooxygenase f...		Potri.005G186150 [exp]	0	1
AT3G07400			lipase class 3 family protein ...		Potri.002G249400 [exp]	8.24	0.7567
AT1G13330		AHP2	Arabidopsis Hop2 homolog (.1)		Potri.010G127101 [exp]	19.07	0.7234
AT3G57810			Cysteine proteinases superfami...		Potri.010G057750 [exp]	28.61	0.6949
					Potri.019G002502 [exp]	35.35	0.6988
AT5G43230			unknown protein		Potri.010G057700 [exp]	37.94	0.7061
AT5G07900			Mitochondrial transcription te...		Potri.009G021701 [exp]	40.49	0.6726
AT1G43760			DNAse I-like superfamily prote...		Potri.005G151350 [exp]	43.49	0.6318
					Potri.005G023301 [exp]	46.46	0.6807
AT1G78280			transferases, transferring gly...		Potri.002G099400 [exp]	59.89	0.6417
AT5G46910			Transcription factor jumonji (...		Potri.003G096100 [exp]	62.52	0.6314

Compare expression of checked genes

Potri.005G186150 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.