PtrTrxm9 (Potri.005G186800) [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol PtrTrxm9
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G03520 152 / 3e-47 ATHM2 Thioredoxin superfamily protein (.1.2)
AT3G15360 151 / 1e-46 ATHM4, ATM4, TRX-M4 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1)
AT1G03680 143 / 1e-43 ATHM1, ATM1, TRX-M1 ARABIDOPSIS THIOREDOXIN M-TYPE 1, thioredoxin M-type 1 (.1)
AT2G15570 112 / 9e-32 TRX-M3, GAT1, ATHM3, ATM3 THIOREDOXIN-M3, GFP ARRESTED TRAFFICKING 1, Arabidopsis thioredoxin M-type 3, Thioredoxin superfamily protein (.1.2)
AT1G76760 85 / 6e-21 ATY1, TRX-Y1 thioredoxin Y1 (.1)
AT1G43560 84 / 1e-20 ATY2 thioredoxin Y2 (.1)
AT1G50320 77 / 9e-18 ATHX, ATX thioredoxin X (.1)
AT3G51030 71 / 2e-16 ATTRX1, ATTRXH1 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1)
AT1G19730 71 / 3e-16 ATTRX4, ATH4 thioredoxin H-type 4, Thioredoxin superfamily protein (.1)
AT5G42980 71 / 3e-16 ATTRXH3, ATTRX3, ATH3 THIOREDOXIN H3, thioredoxin H-type 3, thioredoxin 3 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G073000 294 / 7e-103 AT4G03520 152 / 6e-47 Thioredoxin superfamily protein (.1.2)
Potri.005G058400 203 / 2e-67 AT4G03520 157 / 6e-49 Thioredoxin superfamily protein (.1.2)
Potri.001G401500 173 / 3e-55 AT3G15360 171 / 2e-54 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1)
Potri.011G120700 171 / 3e-54 AT3G15360 190 / 1e-61 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1)
Potri.013G132200 152 / 6e-47 AT4G03520 173 / 4e-55 Thioredoxin superfamily protein (.1.2)
Potri.019G111200 149 / 7e-46 AT4G03520 172 / 9e-55 Thioredoxin superfamily protein (.1.2)
Potri.009G100700 112 / 2e-31 AT2G15570 193 / 2e-63 THIOREDOXIN-M3, GFP ARRESTED TRAFFICKING 1, Arabidopsis thioredoxin M-type 3, Thioredoxin superfamily protein (.1.2)
Potri.007G074000 81 / 3e-19 AT1G50320 201 / 3e-66 thioredoxin X (.1)
Potri.005G193400 79 / 7e-19 AT1G76760 198 / 2e-65 thioredoxin Y1 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10042784 184 / 5e-60 AT3G15360 165 / 4e-52 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1)
Lus10029752 184 / 6e-60 AT3G15360 165 / 3e-52 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1)
Lus10029755 184 / 6e-60 AT3G15360 162 / 3e-51 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1)
Lus10014798 165 / 2e-52 AT3G15360 181 / 2e-58 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1)
Lus10040887 163 / 1e-51 AT3G15360 182 / 4e-59 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1)
Lus10014069 115 / 1e-32 AT2G15570 182 / 3e-59 THIOREDOXIN-M3, GFP ARRESTED TRAFFICKING 1, Arabidopsis thioredoxin M-type 3, Thioredoxin superfamily protein (.1.2)
Lus10019847 113 / 6e-32 AT2G15570 184 / 8e-60 THIOREDOXIN-M3, GFP ARRESTED TRAFFICKING 1, Arabidopsis thioredoxin M-type 3, Thioredoxin superfamily protein (.1.2)
Lus10028569 76 / 2e-17 AT1G76760 174 / 3e-56 thioredoxin Y1 (.1)
Lus10018875 76 / 2e-17 AT1G76760 176 / 6e-57 thioredoxin Y1 (.1)
Lus10030666 71 / 6e-16 AT5G39950 189 / 3e-63 Arabidopsis thioredoxin h2, thioredoxin 2 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0172 Thioredoxin PF13098 Thioredoxin_2 Thioredoxin-like domain
Representative CDS sequence
>Potri.005G186800.1 pacid=42804739 polypeptide=Potri.005G186800.1.p locus=Potri.005G186800 ID=Potri.005G186800.1.v4.1 annot-version=v4.1
ATGGCTATGAAGAATTGTTTCCAAGTTAGTTCAGTGAGTACTACCACCAGAGCTGGTGTTTGCCATCCATTTGCTCCTGTGGAAAAGCTTCAATTGCCAA
CCTGTAAAGGACCCAACACATCCAATTTATCGTTGTCTTCACCTTCTTCATCCTTTCCTCGCTCACTGAGAAGCAGATGCCAAAAATCCCGCGTTGTCTG
CAAAGCTCGTGAAGCTGTAGATGCAGTTCAAGTAGCGACAGATGCAAGCTGGGATACTGTGATTGGAAGCGACACCCCTGTTCTTGTGGAGTTTTGGGCA
CCATGGTGCGGACCTTGTAAGATGATAGCACCGGTAGTCGAGGAGTTGGCAAAAGAATATGCAGGAAAGATAGCTTGTTACAAAGTCAACACTGATGACT
GCCCTAATATTGCCACAAAGTATGGAATAAGAAGCATTCCGACAGTGCTGTTTTTCAAGAAAGGAGAGAAGAAAGAAAGTGTTATTGGAGCAGTGCCCAA
GACCACCTTGTCTAATTCCATAGACAAGTATATAGATGCTTGA
AA sequence
>Potri.005G186800.1 pacid=42804739 polypeptide=Potri.005G186800.1.p locus=Potri.005G186800 ID=Potri.005G186800.1.v4.1 annot-version=v4.1
MAMKNCFQVSSVSTTTRAGVCHPFAPVEKLQLPTCKGPNTSNLSLSSPSSSFPRSLRSRCQKSRVVCKAREAVDAVQVATDASWDTVIGSDTPVLVEFWA
PWCGPCKMIAPVVEELAKEYAGKIACYKVNTDDCPNIATKYGIRSIPTVLFFKKGEKKESVIGAVPKTTLSNSIDKYIDA

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G03520 ATHM2 Thioredoxin superfamily protei... Potri.005G186800 0 1 PtrTrxm9
AT1G32060 PRK phosphoribulokinase (.1) Potri.001G134000 1.00 0.9931
AT2G22780 PMDH1 peroxisomal NAD-malate dehydro... Potri.009G081600 2.82 0.9867 MDHG.1
AT3G14420 Aldolase-type TIM barrel famil... Potri.001G394400 3.00 0.9861
AT5G36700 ATPGLP1, 2-PHOS... 2-phosphoglycolate phosphatase... Potri.010G180400 3.46 0.9860
AT5G23060 CaS calcium sensing receptor (.1) Potri.015G052200 5.47 0.9829
AT5G55570 unknown protein Potri.011G085501 5.47 0.9830
AT4G03520 ATHM2 Thioredoxin superfamily protei... Potri.002G073000 6.92 0.9780
AT1G18730 PnsB4, NDF6 Photosynthetic NDH subcomplex... Potri.012G068500 8.36 0.9773
AT1G70760 NdhL, CRR23 NADH dehydrogenase-like comple... Potri.010G110400 10.24 0.9783
AT1G03130 PSAD-2 photosystem I subunit D-2 (.1) Potri.010G089400 11.61 0.9777 PSAD1.1

Potri.005G186800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.