Potri.005G189300 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G21326 75 / 6e-16 VQ motif-containing protein (.1)
AT1G21320 68 / 6e-13 nucleotide binding;nucleic acid binding (.1.2)
AT1G68450 54 / 3e-09 PDE337 PIGMENT DEFECTIVE 337, VQ motif-containing protein (.1)
AT3G18690 53 / 3e-08 MKS1 MAP kinase substrate 1 (.1)
AT3G18360 48 / 1e-06 VQ motif-containing protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G070600 235 / 3e-78 AT1G21326 76 / 3e-16 VQ motif-containing protein (.1)
Potri.005G057800 76 / 1e-16 AT3G18690 124 / 2e-35 MAP kinase substrate 1 (.1)
Potri.007G110100 70 / 2e-14 AT3G18690 119 / 3e-33 MAP kinase substrate 1 (.1)
Potri.015G046600 56 / 2e-09 AT3G18360 81 / 2e-18 VQ motif-containing protein (.1)
Potri.012G055900 54 / 1e-08 AT3G18360 73 / 2e-15 VQ motif-containing protein (.1)
Potri.006G199300 49 / 1e-07 AT1G68450 60 / 1e-12 PIGMENT DEFECTIVE 337, VQ motif-containing protein (.1)
Potri.010G123700 47 / 3e-06 AT1G68450 64 / 9e-13 PIGMENT DEFECTIVE 337, VQ motif-containing protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10029768 120 / 1e-33 AT1G21326 79 / 4e-18 VQ motif-containing protein (.1)
Lus10042794 94 / 3e-24 AT1G21326 74 / 9e-17 VQ motif-containing protein (.1)
Lus10028604 62 / 2e-11 ND /
Lus10009033 61 / 5e-11 AT3G18360 110 / 5e-29 VQ motif-containing protein (.1)
Lus10037918 52 / 2e-08 ND /
Lus10012286 41 / 4e-05 AT1G21326 50 / 8e-09 VQ motif-containing protein (.1)
Lus10018905 39 / 0.0007 ND /
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05678 VQ VQ motif
Representative CDS sequence
>Potri.005G189300.1 pacid=42804554 polypeptide=Potri.005G189300.1.p locus=Potri.005G189300 ID=Potri.005G189300.1.v4.1 annot-version=v4.1
ATGGATTCATCAGACTTCCCTATCAGCAGATCACCAAGAAAGGAATTGCAAGGTCCTAGACCACCAGCTTTGAAAATCCGCAAAGATTCACACAAGATCA
AAAAACCCCCGGTAGCCCCACAACCATCACACCAGAAACCACAGAATCAACAACAAATACAGCCACGCCCTCCGGTGATAATCTACACACTGTCACCAAA
GGTGATTCATACAAACCCTAATGACTTCATGACCCTAGTCCAACGTCTTACAGGTTCCTCATCAACTTCCACTTGTTCATCCACATCAACTTCCTCCAAT
CCCTTTAATGATCATGATTGTGGTGCAATATCGCCAGCGGCAAGGTATGCTACAATAGAGAAGGCCAAGTCACCAAAAGATCAGCTAAAGCAGCAGCTAG
GCGGAGATGTGGGTTTTGTTGAAGGGATCATGGAGATCGATCAAGTAATGGAGAGAACAAATTTGGGTCCTGGTATTCTGTCTCCTGGGCCCGCTTCACT
TCCTCCAATACCACCAAACTTCTTCTCTCCAGCATCAGCTGATCCAAACTCGGTTAGCTTCTTCCATGATTTGAGTCCTATTCTTCATGGCAACAGGAAT
TTTATTGAGGGTAGTTTCATGCCTAGTCCTTCAACCTTCTTTTCACCAAGCACTCCATCTATTGACCTTTTCAATAATTTCAATACTTACAATAATTTAT
TTGACTTTTGA
AA sequence
>Potri.005G189300.1 pacid=42804554 polypeptide=Potri.005G189300.1.p locus=Potri.005G189300 ID=Potri.005G189300.1.v4.1 annot-version=v4.1
MDSSDFPISRSPRKELQGPRPPALKIRKDSHKIKKPPVAPQPSHQKPQNQQQIQPRPPVIIYTLSPKVIHTNPNDFMTLVQRLTGSSSTSTCSSTSTSSN
PFNDHDCGAISPAARYATIEKAKSPKDQLKQQLGGDVGFVEGIMEIDQVMERTNLGPGILSPGPASLPPIPPNFFSPASADPNSVSFFHDLSPILHGNRN
FIEGSFMPSPSTFFSPSTPSIDLFNNFNTYNNLFDF

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G21326 VQ motif-containing protein (.... Potri.005G189300 0 1
Potri.002G101101 1.00 0.9527
AT1G55020 ATLOX1, LOX1 ARABIDOPSIS LIPOXYGENASE 1, li... Potri.005G032700 2.82 0.9439
AT1G55020 ATLOX1, LOX1 ARABIDOPSIS LIPOXYGENASE 1, li... Potri.005G032600 4.47 0.9291
AT3G46660 UGT76E12 UDP-glucosyl transferase 76E12... Potri.009G038950 5.19 0.9096
Potri.015G143650 12.48 0.9191
AT5G66420 unknown protein Potri.005G120100 13.11 0.9309
Potri.019G014368 13.19 0.9083
AT1G55020 ATLOX1, LOX1 ARABIDOPSIS LIPOXYGENASE 1, li... Potri.005G032400 14.66 0.9013
AT4G01250 WRKY ATWRKY22, WRKY2... WRKY family transcription fact... Potri.001G099001 16.09 0.9038
Potri.019G014354 17.32 0.9105

Potri.005G189300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.