Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G15120 121 / 2e-38 Ubiquinol-cytochrome C reductase hinge protein (.1.2) AT2G01090 101 / 2e-30 Ubiquinol-cytochrome C reductase hinge protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G069301 [exp] 130 / 1e-41 AT1G15120 125 / 1e-39 Ubiquinol-cytochrome C reductase hinge protein (.1.2) Potri.002G069200 [exp] 118 / 6e-37 AT1G15120 129 / 2e-41 Ubiquinol-cytochrome C reductase hinge protein (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039100 [exp] 124 / 5e-37 AT1G07210 122 / 9e-36 Ribosomal protein S18 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02320 [poplar] [flax] UCR_hinge Ubiquinol-cytochrome C reductase hinge protein
Representative CDS sequence Show only first row Show all	>Potri.005G190901.1 pacid=42805528 polypeptide=Potri.005G190901.1.p locus=Potri.005G190901 ID=Potri.005G190901.1.v4.1 annot-version=v4.1 ATGGCGGACGAAGAACTCGTTGATCAAAAGAAGTATCTTGAGGACTCTTGCAAGCCTAAGTGTGTGAAGCCTCTACTTGAATATGAGGCATGTGTTAAGA GAGTTGAAGGAGATGACACCAGCCAGAAACATTGTACAGGGCAGTACTTTGACTACTGGTTCTGTATTGATAAATGCGTTGCACCAAAGCTACTCTCTAA ACTGAAGTGA
AA sequence Show only first row Show all	>Potri.005G190901.1 pacid=42805528 polypeptide=Potri.005G190901.1.p locus=Potri.005G190901 ID=Potri.005G190901.1.v4.1 annot-version=v4.1 MADEELVDQKKYLEDSCKPKCVKPLLEYEACVKRVEGDDTSQKHCTGQYFDYWFCIDKCVAPKLLSKLK

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G15120			Ubiquinol-cytochrome C reducta...		Potri.005G190901 [exp]	0	1
AT3G52590		HAP4, ERD16, UB...	HAPLESS 4, EARLY-RESPONSIVE TO...		Potri.016G077200 [exp]	5.00	0.9472	UBQ1.3
AT5G14030			translocon-associated protein ...		Potri.001G323400 [exp]	5.65	0.9428
AT3G53020		RPL24B, STV1	SHORT VALVE1, Ribosomal protei...		Potri.015G141900 [exp]	7.54	0.9433
AT3G60770			Ribosomal protein S13/S15 (.1)		Potri.002G146800 [exp]	8.00	0.9453	RPS13.3
AT3G04400		EMB2171	embryo defective 2171, Ribosom...		Potri.004G166200 [exp]	13.07	0.9356
AT2G39960			Microsomal signal peptidase 25...		Potri.010G192700 [exp]	13.49	0.9230
AT2G33040		ATP3	gamma subunit of Mt ATP syntha...		Potri.012G066100 [exp]	14.00	0.9298	ATPC.1
AT3G52580			Ribosomal protein S11 family p...		Potri.004G131800 [exp]	15.65	0.9410	Pt-RPS14.4
AT3G49010		RSU2, ATBBC1	40S RIBOSOMAL PROTEIN, breast ...		Potri.016G082300 [exp]	15.74	0.9364
AT4G33250		ATTIF3K1, EIF3K	eukaryotic translation initiat...		Potri.018G063600 [exp]	17.32	0.9069	TIF3.1

Compare expression of checked genes

Potri.005G190901 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.