Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	PtrTrxy1
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G76760 198 / 1e-65 ATY1, TRX-Y1 thioredoxin Y1 (.1) AT1G43560 185 / 2e-60 ATY2 thioredoxin Y2 (.1) AT1G03680 87 / 8e-22 ATHM1, ATM1, TRX-M1 ARABIDOPSIS THIOREDOXIN M-TYPE 1, thioredoxin M-type 1 (.1) AT1G50320 86 / 1e-21 ATHX, ATX thioredoxin X (.1) AT3G15360 82 / 1e-19 ATHM4, ATM4, TRX-M4 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1) AT3G51030 74 / 2e-17 ATTRX1, ATTRXH1 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) AT4G03520 75 / 3e-17 ATHM2 Thioredoxin superfamily protein (.1.2) AT2G15570 73 / 1e-16 TRX-M3, GAT1, ATHM3, ATM3 THIOREDOXIN-M3, GFP ARRESTED TRAFFICKING 1, Arabidopsis thioredoxin M-type 3, Thioredoxin superfamily protein (.1.2) AT1G59730 70 / 1e-15 ATH7 thioredoxin H-type 7 (.1) AT1G45145 69 / 2e-15 LIV1, ATTRX5, ATH5 LOCUS OF INSENSITIVITY TO VICTORIN 1, thioredoxin H-type 5 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G066800 [exp] 268 / 2e-93 AT1G76760 192 / 2e-63 thioredoxin Y1 (.1) Potri.007G074000 [exp] 92 / 9e-24 AT1G50320 201 / 3e-66 thioredoxin X (.1) Potri.001G401500 [exp] 87 / 6e-22 AT3G15360 171 / 2e-54 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1) Potri.005G058400 [exp] 87 / 7e-22 AT4G03520 157 / 6e-49 Thioredoxin superfamily protein (.1.2) Potri.011G120700 [exp] 84 / 1e-20 AT3G15360 190 / 1e-61 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1) Potri.002G073000 [exp] 84 / 3e-20 AT4G03520 152 / 6e-47 Thioredoxin superfamily protein (.1.2) Potri.013G132200 [exp] 81 / 2e-19 AT4G03520 173 / 4e-55 Thioredoxin superfamily protein (.1.2) Potri.019G111200 [exp] 81 / 2e-19 AT4G03520 172 / 9e-55 Thioredoxin superfamily protein (.1.2) Potri.005G186800 [exp] 80 / 4e-19 AT4G03520 152 / 3e-47 Thioredoxin superfamily protein (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018875 [exp] 185 / 2e-60 AT1G76760 176 / 6e-57 thioredoxin Y1 (.1) Lus10028569 [exp] 184 / 8e-60 AT1G76760 174 / 3e-56 thioredoxin Y1 (.1) Lus10014798 [exp] 90 / 6e-23 AT3G15360 181 / 2e-58 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1) Lus10040887 [exp] 89 / 2e-22 AT3G15360 182 / 4e-59 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1) Lus10042784 [exp] 86 / 2e-21 AT3G15360 165 / 4e-52 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1) Lus10029752 [exp] 86 / 2e-21 AT3G15360 165 / 3e-52 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1) Lus10029755 [exp] 85 / 3e-21 AT3G15360 162 / 3e-51 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1) Lus10024293 [exp] 78 / 6e-19 AT3G51030 162 / 4e-53 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Lus10041799 [exp] 77 / 2e-18 AT3G51030 182 / 8e-61 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Lus10000802 [exp] 74 / 2e-17 AT3G51030 165 / 5e-54 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0172 [poplar] [flax] Thioredoxin PF13098 [poplar] [flax] Thioredoxin_2 Thioredoxin-like domain
Representative CDS sequence Show only first row Show all	>Potri.005G193400.2 pacid=42804815 polypeptide=Potri.005G193400.2.p locus=Potri.005G193400 ID=Potri.005G193400.2.v4.1 annot-version=v4.1 ATGGCGATTTCTTCTCTTTCAGCGTCAACAATTCCTTCATTGAATACTCGCAACTCCACTTCTAATTACTCTTCCAAATTATCTTCGTTTTCTTCTCTCC AGTTTCCAGCACAGCTTCATCGACTTCAGTTTCGGAACAGAGGGGTTTCCTCCCACTCCAGGCAGCGAAATTTGCCCCTGGTTGCAGCAAAGAAGCAAAC TTTTTCCACCTTTGATGAGTTGCTACAGAATTCTGACAAACCCGTGTTCGTTGACTTTTATGCAACCTGGTGTGGTCCTTGTCAATTTATGGCTCCAATT CTCGATGAAGTCGGTGCTGTGCTGAAAGACACGGTTCAGGTGGTGAAAATCGACACTGAGAAATATCCCAGCATTGCTGATAAATACAAAATAGAGGCCT TGCCGACTTTTATCATATTCAAGGATGCAGAGCCATATGATCGTTTTGAGGGTGCTTTGACTAAAGATCAGCTCATCCAACGCATTGAAAGTTCACTGAA TGTCAAGCAATAG
AA sequence Show only first row Show all	>Potri.005G193400.2 pacid=42804815 polypeptide=Potri.005G193400.2.p locus=Potri.005G193400 ID=Potri.005G193400.2.v4.1 annot-version=v4.1 MAISSLSASTIPSLNTRNSTSNYSSKLSSFSSLQFPAQLHRLQFRNRGVSSHSRQRNLPLVAAKKQTFSTFDELLQNSDKPVFVDFYATWCGPCQFMAPI LDEVGAVLKDTVQVVKIDTEKYPSIADKYKIEALPTFIIFKDAEPYDRFEGALTKDQLIQRIESSLNVKQ

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G76760		ATY1, TRX-Y1	thioredoxin Y1 (.1)		Potri.005G193400 [exp]	0	1	PtrTrxy1
AT5G65840			Thioredoxin superfamily protei...		Potri.014G012100 [exp]	1.00	0.9874
AT3G52380		CP33, PDE322	PIGMENT DEFECTIVE 322, chlorop...		Potri.016G068300 [exp]	2.00	0.9844	CP33.2
AT3G15840		PIFI	post-illumination chlorophyll ...		Potri.001G204300 [exp]	3.00	0.9819
AT3G46660		UGT76E12	UDP-glucosyl transferase 76E12...		Potri.001G245900 [exp]	3.46	0.9777
AT3G52380		CP33, PDE322	PIGMENT DEFECTIVE 322, chlorop...		Potri.006G202000 [exp]	4.00	0.9811
AT2G43950		OEP37, ATOEP37	ARABIDOPSIS CHLOROPLAST OUTER ...		Potri.017G007300 [exp]	5.00	0.9780
AT1G27385			unknown protein		Potri.001G056500 [exp]	9.48	0.9722
AT2G01590		CRR3	chlororespiratory reduction 3 ...		Potri.010G110100 [exp]	10.95	0.9699
AT3G20230			Ribosomal L18p/L5e family prot...		Potri.013G108700 [exp]	11.95	0.9713
AT2G04530		CPZ, TRZ2	TRNASE Z 2, Metallo-hydrolase/...		Potri.014G160600 [exp]	12.96	0.9757

Compare expression of checked genes

Potri.005G193400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.