Plant FIBer expression Database

Potri.005G193800 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G193600
[exp]
131 / 2e-40 ND /
Potri.005G193901
[exp]
99 / 1e-27 ND /
Flax homologues

No hit found
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02496 ABA_WDS ABA/WDS induced protein
Representative CDS sequence
>Potri.005G193800.3 pacid=42805497 polypeptide=Potri.005G193800.3.p locus=Potri.005G193800 ID=Potri.005G193800.3.v4.1 annot-version=v4.1
ATGGCCGAAGAGAAGCAGCACCAAGGCGTCTTCCACCACCACAAGAGCGAGGAGAAACCAGAGACTGCCACAGGTTATGATGCTCCACCTCCTCCTGTTT
CAGATGTTGATTACAGAAAAGAAAAGAAGCATCACAAGAATCTTGAGCACGTTGCTGAGCTTGGAACTGCTGGCGCTGGTGCTTTTGCCATGAATGAGAA
GCACAAGACAAAGAAAGACCCAGAGCATCCACACAGGCACAAGATAAAGGAGGAGATTGCCGCGGCAGCTGCAGTTGGAACCTGTGGACTTGTATTCCAT
GAGCATCATGAGAAGAAAGCAACCAAGAAAGAGGAAGAAGAGGCTAATGGAAAGAAGCACCACCACTTCTAA
AA sequence
>Potri.005G193800.3 pacid=42805497 polypeptide=Potri.005G193800.3.p locus=Potri.005G193800 ID=Potri.005G193800.3.v4.1 annot-version=v4.1
MAEEKQHQGVFHHHKSEEKPETATGYDAPPPPVSDVDYRKEKKHHKNLEHVAELGTAGAGAFAMNEKHKTKKDPEHPHRHKIKEEIAAAAAVGTCGLVFH
EHHEKKATKKEEEEANGKKHHHF

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.005G193800
[exp]
0 1
AT5G64700 nodulin MtN21 /EamA-like trans... Potri.001G307800
[exp]
1.41 0.8356 N21L9
AT1G55580 GRAS SCL18, LAS SCARECROW-LIKE 18, Lateral Sup... Potri.012G020200
[exp]
2.64 0.8630 Pt-LAS.3
AT3G11690 unknown protein Potri.006G200100
[exp]
7.48 0.8044
AT1G55580 GRAS SCL18, LAS SCARECROW-LIKE 18, Lateral Sup... Potri.001G473200
[exp]
15.49 0.8153
Potri.019G109200
[exp]
15.49 0.7340
AT2G16230 O-Glycosyl hydrolases family 1... Potri.014G184600
[exp]
16.88 0.8087
AT2G20430 RIC6 ROP-interactive CRIB motif-con... Potri.002G035500
[exp]
18.54 0.8101
AT5G42720 Glycosyl hydrolase family 17 p... Potri.014G183000
[exp]
32.24 0.7891
AT4G01240 S-adenosyl-L-methionine-depend... Potri.004G116900
[exp]
32.40 0.8020
AT1G67340 HCP-like superfamily protein w... Potri.012G097600
[exp]
32.86 0.6175

Potri.005G193800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.