Potri.005G195200 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G64620 42 / 8e-05 ATC/VIF2, C/VIF2 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G012800 175 / 2e-56 ND /
Potri.013G012733 175 / 3e-56 ND /
Potri.013G012766 167 / 6e-53 ND /
Potri.005G022200 147 / 3e-45 ND /
Potri.005G022250 145 / 2e-44 ND /
Potri.005G022300 143 / 2e-43 ND /
Potri.005G022400 140 / 2e-42 ND /
Potri.001G073350 125 / 1e-36 ND /
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10007598 96 / 1e-24 ND 42 / 2e-04
Lus10000961 89 / 4e-22 ND 39 / 5e-04
Lus10040145 87 / 2e-21 ND 40 / 4e-04
Lus10027768 62 / 6e-12 ND /
Lus10011019 57 / 2e-09 AT4G17610 1595 / 0.0 tRNA/rRNA methyltransferase (SpoU) family protein (.1)
Lus10000822 44 / 3e-05 AT1G47960 113 / 1e-31 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10041650 42 / 0.0001 AT1G48020 85 / 4e-21 ARABIDOPSIS THALIANA PECTIN METHYLESTERASE INHIBITOR 1, pectin methylesterase inhibitor 1 (.1)
Lus10003530 42 / 0.0001 AT1G47960 91 / 5e-23 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10037793 42 / 0.0001 AT3G17152 74 / 5e-16 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10002933 41 / 0.0002 AT1G47960 89 / 3e-22 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04043 PMEI Plant invertase/pectin methylesterase inhibitor
Representative CDS sequence
>Potri.005G195200.1 pacid=42804453 polypeptide=Potri.005G195200.1.p locus=Potri.005G195200 ID=Potri.005G195200.1.v4.1 annot-version=v4.1
ATGGGTTCTAGCAATCGCACTTTGATTTTCGCTACCATTTTCTTGTACCTGCTCCTGCATTTCCCTTCTCAAACCGAGGCTAGAGGTCTCAAGTCTCCAG
CCAAATGTCCGAAATTACTGAGTCAGGTTTGCAAGACAAGCCAGAACTATGCATTCTGCGTGAGAGTTCTCATGTCCAATCCTCTGACATTGTTGGCTCC
TAATACAAAGGGCATTGTTGTGAATGCCCTGGACATAGTAAGAAAAGAATCCATGAAGACAAGCAAGTTCTTTGATGGATTGGTCAATGGCAAAGGCACG
GTGCCTGCTTTTAAGCCAGCCCTCAAGGAATGTGCATCTGATTTTAAGAAGGCTTCAGGGCTTATGAACCTCAAGGTGCTAGAAGGTGATTTTGCAACCA
TGGATGTGAATTATGCTCTTGATGATGCTCGAAGCTGTGAGACTAAATTGTCGATGGATGAGGTTAACATTAAATCAATTCCTGCTGCAATTAAGAACTG
GAAGAATTTCTATGCTGTTGCTAACGCGGCCGCACTAACCCTGGAAAATCTTCAAAATTAA
AA sequence
>Potri.005G195200.1 pacid=42804453 polypeptide=Potri.005G195200.1.p locus=Potri.005G195200 ID=Potri.005G195200.1.v4.1 annot-version=v4.1
MGSSNRTLIFATIFLYLLLHFPSQTEARGLKSPAKCPKLLSQVCKTSQNYAFCVRVLMSNPLTLLAPNTKGIVVNALDIVRKESMKTSKFFDGLVNGKGT
VPAFKPALKECASDFKKASGLMNLKVLEGDFATMDVNYALDDARSCETKLSMDEVNIKSIPAAIKNWKNFYAVANAAALTLENLQN

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G64620 ATC/VIF2, C/VIF... cell wall / vacuolar inhibitor... Potri.005G195200 0 1
AT1G10070 ATBCAT-2 branched-chain amino acid tran... Potri.009G082700 19.74 0.9557
AT3G11310 unknown protein Potri.010G022201 23.91 0.9518
AT2G24940 ATMAPR2 membrane-associated progestero... Potri.006G266200 26.26 0.9409
Potri.017G069550 27.34 0.9412
AT1G30760 FAD-binding Berberine family p... Potri.011G160700 28.63 0.8938
AT4G34135 UGT73B2 UDP-glucosyltransferase 73B2 (... Potri.005G010016 30.41 0.9394
AT2G47760 AtALG3, ALG3 Arabidopsis thaliana asparagin... Potri.014G131600 32.44 0.9247
AT4G33870 Peroxidase superfamily protein... Potri.003G053700 37.49 0.9248
Potri.006G174801 37.94 0.9403
AT5G62280 Protein of unknown function (D... Potri.002G147200 39.76 0.9155

Potri.005G195200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.