OHP2.1 (Potri.005G196100) [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol OHP2.1
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G34000 154 / 8e-48 OHP2 one-helix protein 2 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G065000 197 / 7e-65 AT1G34000 154 / 4e-48 one-helix protein 2 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10017779 147 / 5e-45 AT1G34000 173 / 2e-55 one-helix protein 2 (.1)
Lus10000462 144 / 9e-44 AT1G34000 166 / 9e-53 one-helix protein 2 (.1)
PFAM info
Representative CDS sequence
>Potri.005G196100.1 pacid=42804492 polypeptide=Potri.005G196100.1.p locus=Potri.005G196100 ID=Potri.005G196100.1.v4.1 annot-version=v4.1
ATGTCAGTGGCATCCTCAATTCCGTACATCAAAATCCCAAACCCATCATCATCATCTTGCTCCTCTCTATCTTCCTCTTCATCAACCTCCTCGACATCTT
CTTACTATAGGTTTTCTACAACAACTAAGCCTTATATTGTGACCATAAGGAGCTCTCAAGCTGAAGGGCCTGTAAGGAGACCCGTGGCCCCTCCTCTTAG
AGAACCTTCCCCGCCTGCATCACCATCGCCTCCCTTGAAGCCCGTTCCTCCTTCTTCACCGTCTTCTCCAGTGGCTCCACCACCCAAGCCAGCTGCTAAG
GTGGCTGTGGAGGACAAAAATGTGATGACTTTGGAGTTTCAGAGACAAAAGGCTAAGGAGCTTCAAGAATATTTTAAGCAGAAGAAGCTTGAGGAAGCAG
ATCAAGGTCCTTTCTTTGGGTTCTTTGGCAAGAATGAGATTGCTAATGGGAGATGGGCAATGTTTGGTTTTGCTGTTGGGATGCTAACAGAGTATGCAAC
GGGCTCAGACTTTGTTGATCAAGTAAAGATTCTTCTGTCCAATTTCGGGATAATAGATCTGGAATAA
AA sequence
>Potri.005G196100.1 pacid=42804492 polypeptide=Potri.005G196100.1.p locus=Potri.005G196100 ID=Potri.005G196100.1.v4.1 annot-version=v4.1
MSVASSIPYIKIPNPSSSSCSSLSSSSSTSSTSSYYRFSTTTKPYIVTIRSSQAEGPVRRPVAPPLREPSPPASPSPPLKPVPPSSPSSPVAPPPKPAAK
VAVEDKNVMTLEFQRQKAKELQEYFKQKKLEEADQGPFFGFFGKNEIANGRWAMFGFAVGMLTEYATGSDFVDQVKILLSNFGIIDLE

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G34000 OHP2 one-helix protein 2 (.1) Potri.005G196100 0 1 OHP2.1
AT5G08410 FTRA2 ferredoxin/thioredoxin reducta... Potri.008G002200 4.00 0.9532
AT1G71480 Nuclear transport factor 2 (NT... Potri.019G074800 5.00 0.9465
AT3G08010 ATAB2 RNA binding (.1) Potri.009G059800 5.65 0.9685
AT3G10670 ABCI6, ATNAP7 ATP-binding cassette I6, non-i... Potri.008G012500 6.16 0.9629 NAP7.2
AT5G49940 ATCNFU2, NFU2 CHLOROPLAST-LOCALIZED NIFU-LIK... Potri.004G222600 6.48 0.9533
AT3G15580 APG8H, ATG8I AUTOPHAGY 8I, AUTOPHAGY 8H, Ub... Potri.002G189450 7.74 0.9518
AT2G01620 MEE11 maternal effect embryo arrest ... Potri.010G108600 9.27 0.9408
AT2G41705 camphor resistance CrcB family... Potri.005G174600 13.41 0.9424
AT5G36120 atylmg3, CCB3 "cofactor assembly, complex C ... Potri.005G199000 14.31 0.9566
AT1G14270 CAAX amino terminal protease f... Potri.008G147600 15.49 0.9535

Potri.005G196100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.