Plant FIBer expression Database

Potri.005G198400 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G71750 269 / 4e-93 HGPT Hypoxanthine-guanine phosphoribosyltransferase (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10023627
[exp]
305 / 3e-107 AT1G71750 264 / 4e-91 Hypoxanthine-guanine phosphoribosyltransferase (.1.2)
Lus10024262
[exp]
302 / 3e-106 AT1G71750 259 / 3e-89 Hypoxanthine-guanine phosphoribosyltransferase (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0533 PRTase-like PF00156 Pribosyltran Phosphoribosyl transferase domain
Representative CDS sequence
>Potri.005G198400.1 pacid=42805466 polypeptide=Potri.005G198400.1.p locus=Potri.005G198400 ID=Potri.005G198400.1.v4.1 annot-version=v4.1
ATGTCTTTGGACTCTCACATAGAAAAGGTCCTATGGACCAAGTTCCAAATCTCAAAACGAGTCACCGAACTCGCCTCTCAAATCACCTCCGATTTTTCCT
CTGTTTCTCCCCCTCCACTCGTTGTGGGCGTGGCCACTGGCGCTTTCTTGTTCTTGGCTGACTTGGTCAGGCAAATCCAACTCCCCATTTCCGTTGATTT
CATTCGTGCCGAATCATACGGTTCTGGCACTGAGTCCAGCGGAGCTCCCCGTATTTCCCTCGACTTGAAGCTCGATGTTAAAGAGAAACACGTCATTCTG
GTTGAGGACATTGTAGACACAGGAAACACTTTATCTTGTCTCATTAAACACTTGGAATCCAAGGGAGCATCTGCTGTATCAGTGTGTACTTTCCTTGATA
AACCAACCAGAAGGAAGGTGCATTTTGAACTATTGGGTGATGGAAAATATTACCAAGGATTTGAGTGTCCAGATTACTTTGTCGTGGGTTACGGAATGGA
CTTTGCTGAACTATACAGGAATTTGCCTTATGTTGGTGTCTTGAAGCCTGAATATTACAATTGA
AA sequence
>Potri.005G198400.1 pacid=42805466 polypeptide=Potri.005G198400.1.p locus=Potri.005G198400 ID=Potri.005G198400.1.v4.1 annot-version=v4.1
MSLDSHIEKVLWTKFQISKRVTELASQITSDFSSVSPPPLVVGVATGAFLFLADLVRQIQLPISVDFIRAESYGSGTESSGAPRISLDLKLDVKEKHVIL
VEDIVDTGNTLSCLIKHLESKGASAVSVCTFLDKPTRRKVHFELLGDGKYYQGFECPDYFVVGYGMDFAELYRNLPYVGVLKPEYYN

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G71750 HGPT Hypoxanthine-guanine phosphori... Potri.005G198400
[exp]
0 1
AT2G35320 ATEYA EYES ABSENT homolog (.1) Potri.001G144000
[exp]
1.00 0.8816
AT1G05970 RNA-binding (RRM/RBD/RNP motif... Potri.017G030000
[exp]
2.82 0.8756
AT2G30000 PHF5-like protein (.1) Potri.001G277700
[exp]
3.46 0.8531
AT5G22280 unknown protein Potri.016G073500
[exp]
4.69 0.8367
AT1G31340 NEDD8, ATRUB1, ... ARABIDOPSIS THALIANA RELATED T... Potri.007G067500
[exp]
4.89 0.8716 Pt-UBQ7.1
AT2G27800 Tetratricopeptide repeat (TPR)... Potri.018G093700
[exp]
5.19 0.8401
AT4G13520 SMAP1 small acidic protein 1 (.1) Potri.008G174000
[exp]
6.00 0.8359
AT5G59180 NRPB7 DNA-directed RNA polymerase II... Potri.001G377200
[exp]
6.32 0.8464 RPB19.1
AT5G46030 unknown protein Potri.011G097300
[exp]
6.70 0.8538
AT5G67260 CYCD3;2 CYCLIN D3;2 (.1) Potri.007G048300
[exp]
7.07 0.8394 Pt-CYCD3.3

Potri.005G198400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.