Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	RAB7.1
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G09720 370 / 2e-132 AtRABG3a RAB GTPase homolog G3A (.1.2.3.4) AT1G22740 349 / 3e-124 RAB75, RAB7, AtRABG3b RAB GTPase homolog G3B (.1) AT1G52280 310 / 6e-109 AtRABG3d RAB GTPase homolog G3D (.1) AT2G21880 309 / 2e-108 AtRab7A, AtRABG2 ARABIDOPSIS RAB GTPASE HOMOLOG G2, RAB GTPase homolog 7A (.1.2) AT3G18820 308 / 4e-108 RAB71, AtRABG3f, AtRab7B RAB GTPase homolog G3F (.1) AT3G16100 307 / 1e-107 AtRABG3c, AtRab7D RAB GTPase homolog G3C (.1) AT1G49300 301 / 4e-105 ATRAB7, ATRABG3E ARABIDOPSIS RAB GTPASE HOMOLOG G3E, ARABIDOPSIS RAB GTPASE HOMOLOG 7, RAB GTPase homolog G3E (.1.2) AT5G39620 236 / 2e-79 AtRABG1 RAB GTPase homolog G1 (.1) AT5G47960 135 / 1e-39 SMG1, AtRABA4c SMALL MOLECULAR WEIGHT G-PROTEIN 1, RAB GTPase homolog A4C (.1) AT3G12160 135 / 2e-39 AtRABA4d ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A4D, RAB GTPase homolog A4D (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G062400 [exp] 404 / 4e-146 AT4G09720 375 / 1e-134 RAB GTPase homolog G3A (.1.2.3.4) Potri.005G085300 [exp] 330 / 2e-116 AT4G09720 291 / 3e-101 RAB GTPase homolog G3A (.1.2.3.4) Potri.009G115000 [exp] 312 / 2e-109 AT3G18820 408 / 2e-147 RAB GTPase homolog G3F (.1) Potri.004G153400 [exp] 310 / 1e-108 AT3G18820 405 / 2e-146 RAB GTPase homolog G3F (.1) Potri.003G053400 [exp] 292 / 1e-101 AT1G52280 395 / 2e-142 RAB GTPase homolog G3D (.1) Potri.001G182900 [exp] 287 / 1e-99 AT3G16100 394 / 7e-142 RAB GTPase homolog G3C (.1) Potri.007G079700 [exp] 282 / 5e-98 AT4G09720 272 / 3e-94 RAB GTPase homolog G3A (.1.2.3.4) Potri.003G086700 [exp] 132 / 2e-38 AT2G44610 397 / 4e-143 Ras-related small GTP-binding family protein (.1) Potri.001G270100 [exp] 132 / 2e-38 AT3G12160 379 / 2e-135 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A4D, RAB GTPase homolog A4D (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028719 [exp] 363 / 6e-130 AT4G09720 341 / 5e-121 RAB GTPase homolog G3A (.1.2.3.4) Lus10006059 [exp] 346 / 5e-123 AT4G09720 323 / 4e-114 RAB GTPase homolog G3A (.1.2.3.4) Lus10035872 [exp] 313 / 8e-110 AT1G52280 397 / 4e-143 RAB GTPase homolog G3D (.1) Lus10040468 [exp] 312 / 2e-109 AT3G18820 403 / 2e-145 RAB GTPase homolog G3F (.1) Lus10042328 [exp] 279 / 3e-96 AT3G18820 367 / 3e-131 RAB GTPase homolog G3F (.1) Lus10023582 [exp] 271 / 2e-93 AT3G18820 330 / 4e-117 RAB GTPase homolog G3F (.1) Lus10025790 [exp] 180 / 1e-57 AT1G52280 257 / 5e-88 RAB GTPase homolog G3D (.1) Lus10023829 [exp] 135 / 3e-38 AT3G12160 377 / 5e-132 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A4D, RAB GTPase homolog A4D (.1) Lus10015297 [exp] 130 / 7e-38 AT5G60860 428 / 6e-155 RAB GTPase homolog A1F (.1) Lus10016284 [exp] 129 / 2e-37 AT3G12160 386 / 2e-138 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A4D, RAB GTPase homolog A4D (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0023 [poplar] [flax] P-loop_NTPase PF00025 [poplar] [flax] Arf ADP-ribosylation factor family
Representative CDS sequence Show only first row Show all	>Potri.005G198800.1 pacid=42805552 polypeptide=Potri.005G198800.1.p locus=Potri.005G198800 ID=Potri.005G198800.1.v4.1 annot-version=v4.1 ATGTCAGCGCGTAGGCGTACCTTGCTCAAGGTCATCGTTCTCGGGGACAGCGGGGCTGGCAAGACGTCGTTAATGAATCAATATGTGCACAAGAAATTTA GTCAGCAATATAAGGCTACAATTGGTGCCGATTTCGTTACCAAAGAACTCCAGATTGATGACAGGCTTGTCACTCTGCAAATATGGGACACGGCTGGGCA AGAAAGATTTCAGTCACTTGGAGTTGCATTTTATAGAGGAGCAGATTGCTGCGCTCTAGTTTATGATGTGAATGTCATGAGATCATTCGATACTCTTGAC AACTGGCACGAAGAGTTCCTTAAACAGGCAAATCCATCTGATCCCAAGACATTTCCGTTTATATTGCTTGGAAACAAGATAGATATTGATGGTGGAAATA GCCGAGTGGTTTCTGAGAAGAAAGCTAAGGACTGGTGTGCGTCGAAAGGAAACATACTTTACTTTGAGACGTCAGCAAAGGAGGATTACAATGTTGATCC TGCATTCTTATCCATTGCAAAAACTGCTCTAGCCCATGAGCATGGACAGGACATATACTTCCAGGGTATCCCAGAGGATGTCACAGAGAATGAGCAAAGA GGTGGCTGTGCATGTTAA
AA sequence Show only first row Show all	>Potri.005G198800.1 pacid=42805552 polypeptide=Potri.005G198800.1.p locus=Potri.005G198800 ID=Potri.005G198800.1.v4.1 annot-version=v4.1 MSARRRTLLKVIVLGDSGAGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDRLVTLQIWDTAGQERFQSLGVAFYRGADCCALVYDVNVMRSFDTLD NWHEEFLKQANPSDPKTFPFILLGNKIDIDGGNSRVVSEKKAKDWCASKGNILYFETSAKEDYNVDPAFLSIAKTALAHEHGQDIYFQGIPEDVTENEQR GGCAC

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G09720		AtRABG3a	RAB GTPase homolog G3A (.1.2.3...		Potri.005G198800 [exp]	0	1	RAB7.1
AT4G02450			HSP20-like chaperones superfam...		Potri.002G061500 [exp]	1.00	0.8661
AT3G18820		RAB71, AtRABG3f...	RAB GTPase homolog G3F (.1)		Potri.009G115000 [exp]	1.41	0.8309	Pt-ACT2.1
AT5G59480			Haloacid dehalogenase-like hyd...		Potri.001G242300 [exp]	4.24	0.7665
AT3G63530		BB2, BB	BIG BROTHER, RING/U-box superf...		Potri.001G019600 [exp]	7.00	0.7302
AT3G51030		ATTRX1, ATTRXH1	ARABIDOPSIS THALIANA THIOREDOX...		Potri.007G018000 [exp]	8.06	0.7404	Pt-TRXH.1,PtrTrxh4
AT3G25570			Adenosylmethionine decarboxyla...		Potri.010G133900 [exp]	9.16	0.6727	SAMDC.2
AT3G01280		VDAC1, ATVDAC1	ARABIDOPSIS THALIANA VOLTAGE D...		Potri.010G033500 [exp]	14.69	0.7345	POR1.2
AT4G38800		ATMTN1, ATMTAN1	ARABIDOPSIS METHYLTHIOADENOSIN...		Potri.004G167200 [exp]	15.16	0.7104
AT3G02630			Plant stearoyl-acyl-carrier-pr...		Potri.010G179400 [exp]	15.49	0.7035
AT3G50120			Plant protein of unknown funct...		Potri.006G042946 [exp]	16.37	0.7416

Compare expression of checked genes

Potri.005G198800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.