EXT.13 (Potri.005G201200) [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol EXT.13
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G14130 404 / 4e-143 XTR7, XTH15 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
AT3G23730 400 / 1e-141 XTH16 xyloglucan endotransglucosylase/hydrolase 16 (.1)
AT4G25810 370 / 9e-130 XTH23, XTR6 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
AT5G57560 367 / 1e-128 XTH22, TCH4 xyloglucan endotransglucosylase/hydrolase 22, Touch 4, Xyloglucan endotransglucosylase/hydrolase family protein (.1)
AT4G30270 365 / 7e-128 XTH24, SEN4, BRU1, MERI-5, MERI5B SENESCENCE 4, meristem-5, MERISTEM 5, xyloglucan endotransglucosylase/hydrolase 24 (.1)
AT5G57550 360 / 1e-125 XTR3, XTH25, EXGT-A5 xyloglucan endotransglycosylase 3, xyloglucan endotransglucosylase/hydrolase 25 (.1)
AT5G57540 348 / 6e-121 AtXTH13, XTH13 xyloglucan endotransglucosylase/hydrolase 13 (.1)
AT5G57530 347 / 8e-121 AtXTH12, XTH12 xyloglucan endotransglucosylase/hydrolase 12 (.1)
AT5G48070 343 / 4e-119 XTH20, ATXTH20 xyloglucan endotransglucosylase/hydrolase 20 (.1)
AT4G25820 341 / 2e-118 ATXTH14, XTR9, XTH14 xyloglucan endotransglycosylase 9, xyloglucan endotransglucosylase/hydrolase 14 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G201250 541 / 0 AT4G14130 395 / 2e-139 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Potri.002G060500 503 / 0 AT4G14130 424 / 3e-151 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Potri.002G060400 463 / 1e-166 AT4G14130 402 / 2e-142 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Potri.002G236200 428 / 1e-152 AT3G23730 436 / 1e-155 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Potri.014G146100 426 / 7e-152 AT3G23730 451 / 1e-161 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Potri.011G077320 394 / 5e-139 AT3G23730 386 / 7e-136 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Potri.013G005700 389 / 1e-136 AT4G25810 431 / 5e-153 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Potri.018G095100 378 / 6e-133 AT4G25810 420 / 1e-149 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Potri.018G095200 376 / 4e-132 AT4G25810 414 / 3e-147 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10010939 425 / 2e-151 AT3G23730 384 / 2e-135 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10031393 421 / 7e-150 AT3G23730 388 / 8e-137 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10010938 417 / 2e-148 AT4G14130 386 / 3e-136 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Lus10031392 417 / 4e-148 AT3G23730 384 / 3e-135 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10010936 415 / 2e-147 AT3G23730 382 / 2e-134 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10028947 414 / 4e-147 AT4G14130 437 / 2e-156 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Lus10034098 411 / 8e-146 AT3G23730 376 / 5e-132 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10003048 410 / 3e-145 AT3G23730 380 / 7e-134 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10000678 403 / 1e-142 AT3G23730 410 / 6e-146 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10020773 401 / 6e-142 AT3G23730 394 / 4e-139 xyloglucan endotransglucosylase/hydrolase 16 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0004 Concanavalin PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16
CL0004 Concanavalin PF06955 XET_C Xyloglucan endo-transglycosylase (XET) C-terminus
Representative CDS sequence
>Potri.005G201200.1 pacid=42805458 polypeptide=Potri.005G201200.1.p locus=Potri.005G201200 ID=Potri.005G201200.1.v4.1 annot-version=v4.1
ATGTCTTTCTCTTGTTCGAGTAGACTTTCTTCCATGCCTTTGTTTGCTCTGTTAATTGCTTGTCTAGTGGGAGCCTCCATGGGTGGCAATTTCTTCCAAG
ATTTTGACATCACCTGGGGCGATCAACGTGCTAAGATACTAAATGGTGGCCAACTTCTCACACTATCTCTTGACAAGGATTCTGGTTCTGGCTTCCGATC
CAAGAATGAGTACTTGTTTGGCCGAATCGACATGCAAATCAAGCTAGTATCGGGCAACTCGGCTGGCACTGTCACCACATACTATCTATCTTCTCAAGGG
CCGACCCACGACGAGATTGACTTCGAGTTTCTAGGCAATTTAACTGGAGAACCATATACTCTCCATACCAATGTGTTCTCCCAAGGGAAAGGCAACAAAG
AACAGCAGTTTTATCTCTGGTTTGATCCCACAAAGGCTTTCCACACCTACTCTATTGTGTGGAACCAACAACAAATAATTTTCTTGGTGGACAACATCCC
CATAAGAGTATTCCACAACTCGGAATCAATCGGAGTGCCGTTCCCGACGAAGCAACCCATGAGGATATATTCGAGTCTCTGGAATGCTGATGATTGGGCA
ACGAGAGGGGGGCTTGTGAAGACTGACTGGACACAAGCTCCTTTCACTGCTTCTTACAGAAATTTCAAAGCCAGTGCTTGTGTTTCGTCACCTGTATCAT
CTTGCACCTCCACCTCCCCCAATTCCTTGCAGGACAGTACCTGGCAAGTTCAAGCTCTTGATGCCTCCGGCCGCAACAGGCTTCGATGGGTGCAGCAGAA
GTACATGATTTACAACTACTGCACTGACTTGAAACGATTCCCTCAGGGTATCCCAGCTGAATGCAAGCGATCAAGATTCCTTTGA
AA sequence
>Potri.005G201200.1 pacid=42805458 polypeptide=Potri.005G201200.1.p locus=Potri.005G201200 ID=Potri.005G201200.1.v4.1 annot-version=v4.1
MSFSCSSRLSSMPLFALLIACLVGASMGGNFFQDFDITWGDQRAKILNGGQLLTLSLDKDSGSGFRSKNEYLFGRIDMQIKLVSGNSAGTVTTYYLSSQG
PTHDEIDFEFLGNLTGEPYTLHTNVFSQGKGNKEQQFYLWFDPTKAFHTYSIVWNQQQIIFLVDNIPIRVFHNSESIGVPFPTKQPMRIYSSLWNADDWA
TRGGLVKTDWTQAPFTASYRNFKASACVSSPVSSCTSTSPNSLQDSTWQVQALDASGRNRLRWVQQKYMIYNYCTDLKRFPQGIPAECKRSRFL

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G14130 XTR7, XTH15 xyloglucan endotransglycosylas... Potri.005G201200 0 1 EXT.13
AT4G14130 XTR7, XTH15 xyloglucan endotransglycosylas... Potri.005G201250 1.00 0.9795
AT4G19230 CYP707A1 "cytochrome P450, family 707, ... Potri.004G235400 2.00 0.9000 Pt-CYP707.6
AT5G51990 AP2_ERF CBF4, DREB1D DEHYDRATION-RESPONSIVE ELEMENT... Potri.012G134100 3.46 0.8627
AT3G61220 SDR1 short-chain dehydrogenase/redu... Potri.002G156833 7.00 0.8083
AT5G25810 AP2_ERF TNY, TINY TINY, Integrase-type DNA-bindi... Potri.019G067400 11.31 0.8060
AT3G14470 NB-ARC domain-containing disea... Potri.017G133600 18.11 0.8271
AT4G08950 EXO EXORDIUM, Phosphate-responsive... Potri.005G163700 19.89 0.7851
AT4G08950 EXO EXORDIUM, Phosphate-responsive... Potri.002G098800 21.63 0.7795
AT4G08950 EXO EXORDIUM, Phosphate-responsive... Potri.005G163500 25.39 0.7678
AT3G61220 SDR1 short-chain dehydrogenase/redu... Potri.002G156701 25.80 0.7128

Potri.005G201200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.