Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G14130 394 / 2e-139 XTR7, XTH15 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1) AT3G23730 385 / 1e-135 XTH16 xyloglucan endotransglucosylase/hydrolase 16 (.1) AT4G25810 365 / 1e-127 XTH23, XTR6 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1) AT4G30270 361 / 2e-126 XTH24, SEN4, BRU1, MERI-5, MERI5B SENESCENCE 4, meristem-5, MERISTEM 5, xyloglucan endotransglucosylase/hydrolase 24 (.1) AT5G57560 360 / 1e-125 XTH22, TCH4 xyloglucan endotransglucosylase/hydrolase 22, Touch 4, Xyloglucan endotransglucosylase/hydrolase family protein (.1) AT5G57550 352 / 8e-123 XTR3, XTH25, EXGT-A5 xyloglucan endotransglycosylase 3, xyloglucan endotransglucosylase/hydrolase 25 (.1) AT5G57540 346 / 3e-120 AtXTH13, XTH13 xyloglucan endotransglucosylase/hydrolase 13 (.1) AT5G57530 345 / 6e-120 AtXTH12, XTH12 xyloglucan endotransglucosylase/hydrolase 12 (.1) AT5G48070 338 / 4e-117 XTH20, ATXTH20 xyloglucan endotransglucosylase/hydrolase 20 (.1) AT4G25820 334 / 2e-115 ATXTH14, XTR9, XTH14 xyloglucan endotransglycosylase 9, xyloglucan endotransglucosylase/hydrolase 14 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G201200 [exp] 508 / 0 AT4G14130 405 / 2e-143 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1) Potri.002G060500 [exp] 475 / 5e-171 AT4G14130 424 / 3e-151 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1) Potri.002G060400 [exp] 455 / 4e-163 AT4G14130 402 / 2e-142 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1) Potri.002G236200 [exp] 417 / 2e-148 AT3G23730 436 / 1e-155 xyloglucan endotransglucosylase/hydrolase 16 (.1) Potri.014G146100 [exp] 414 / 4e-147 AT3G23730 451 / 1e-161 xyloglucan endotransglucosylase/hydrolase 16 (.1) Potri.011G077320 [exp] 385 / 2e-135 AT3G23730 386 / 7e-136 xyloglucan endotransglucosylase/hydrolase 16 (.1) Potri.013G005700 [exp] 381 / 3e-133 AT4G25810 431 / 5e-153 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1) Potri.018G095100 [exp] 377 / 1e-132 AT4G25810 420 / 1e-149 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1) Potri.018G095200 [exp] 375 / 1e-131 AT4G25810 414 / 3e-147 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031393 [exp] 419 / 6e-149 AT3G23730 388 / 8e-137 xyloglucan endotransglucosylase/hydrolase 16 (.1) Lus10010939 [exp] 418 / 1e-148 AT3G23730 384 / 2e-135 xyloglucan endotransglucosylase/hydrolase 16 (.1) Lus10010938 [exp] 416 / 6e-148 AT4G14130 386 / 3e-136 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1) Lus10031392 [exp] 416 / 9e-148 AT3G23730 384 / 3e-135 xyloglucan endotransglucosylase/hydrolase 16 (.1) Lus10010936 [exp] 413 / 2e-146 AT3G23730 382 / 2e-134 xyloglucan endotransglucosylase/hydrolase 16 (.1) Lus10003048 [exp] 407 / 2e-144 AT3G23730 380 / 7e-134 xyloglucan endotransglucosylase/hydrolase 16 (.1) Lus10034098 [exp] 407 / 3e-144 AT3G23730 376 / 5e-132 xyloglucan endotransglucosylase/hydrolase 16 (.1) Lus10007349 [exp] 402 / 3e-142 AT3G23730 394 / 4e-139 xyloglucan endotransglucosylase/hydrolase 16 (.1) Lus10020773 [exp] 400 / 2e-141 AT3G23730 394 / 4e-139 xyloglucan endotransglucosylase/hydrolase 16 (.1) Lus10020772 [exp] 399 / 4e-141 AT3G23730 393 / 7e-139 xyloglucan endotransglucosylase/hydrolase 16 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0004 [poplar] [flax] Concanavalin PF00722 [poplar] [flax] Glyco_hydro_16 Glycosyl hydrolases family 16 CL0004 [poplar] [flax] Concanavalin PF06955 [poplar] [flax] XET_C Xyloglucan endo-transglycosylase (XET) C-terminus
Representative CDS sequence Show only first row Show all	>Potri.005G201250.1 pacid=42804711 polypeptide=Potri.005G201250.1.p locus=Potri.005G201250 ID=Potri.005G201250.1.v4.1 annot-version=v4.1 ATGTCATTCTCTTGTCCTAGTAAACTTCCCTCGACGCTTCTGTTTGCTTCATTACTTGCTTGTCTACTGGGAGCCTCCATGGGTGGCAATTTCTTCCAAG ATTTTGACATCACCTGGGGCGATCAACGTGCTAAGATACTAAATGGTGGCCAACTTCTCACACTATCTCTTGACAAGGATTCTGGTTCTGGCTTCCGATC CAAGAATGAGTACTTGTTTGGCCGAATCGACATGCAAATCAAGCTAGTATCGGGCAACTCGGCTGGCACTGTCACCACATACTATCTATCTTCTCAAGGG CCGACCCACGACGAGATTGACTTCGAGTTTCTAGGCAATGTAACTGGAGAACCATATACTCTCCATACCAATGTGTTCTCCCAAGGGAAAGGCAACAAAG AACAGCAGTTTTATCTCTGGTTTGATCCCACAAAGGCTTTCCACACCTACTCTATTGTGTGGAACCAACAACGAATAATTTTCTTGGTGGACAACATCCC CATAAGAGTATTCCACAACTCGGAATCAATCGGAGTGCCGTTCCCGACGAAGCAACCCATGAGGATATATTCGAGTCTCTGGAATGCTGATGATTGGGCA ACGAGAGGGGGGCTTGTGAAGACTGACTGGACACAAGCTCCTTTCACTGCTTCTTACAGAAATTTCAAAGCCAGTGCTTGTGTTTCGTCACCTGGATCAT CTTGCACCTCCACCTCCCCCAATTCCTTGCAGGACAGTACCTGGCAAGTTCAAGCTCTTGATGCCTCCGGCCGCAACAGGCTTCGATGGGTGCAGCAGAA GTACATGATTTACAACTACTGCACTGACTTGAAACGATTCCCTCAGGGTATCCCAGCTGAATGCAAGCGATCAAGATTCCTTTGA
AA sequence Show only first row Show all	>Potri.005G201250.1 pacid=42804711 polypeptide=Potri.005G201250.1.p locus=Potri.005G201250 ID=Potri.005G201250.1.v4.1 annot-version=v4.1 MSFSCPSKLPSTLLFASLLACLLGASMGGNFFQDFDITWGDQRAKILNGGQLLTLSLDKDSGSGFRSKNEYLFGRIDMQIKLVSGNSAGTVTTYYLSSQG PTHDEIDFEFLGNVTGEPYTLHTNVFSQGKGNKEQQFYLWFDPTKAFHTYSIVWNQQRIIFLVDNIPIRVFHNSESIGVPFPTKQPMRIYSSLWNADDWA TRGGLVKTDWTQAPFTASYRNFKASACVSSPGSSCTSTSPNSLQDSTWQVQALDASGRNRLRWVQQKYMIYNYCTDLKRFPQGIPAECKRSRFL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G14130		XTR7, XTH15	xyloglucan endotransglycosylas...		Potri.005G201250 [exp]	0	1
AT4G14130		XTR7, XTH15	xyloglucan endotransglycosylas...		Potri.005G201200 [exp]	1.00	0.9795	EXT.13
AT4G19230		CYP707A1	"cytochrome P450, family 707, ...		Potri.004G235400 [exp]	1.41	0.9116	Pt-CYP707.6
AT3G54000			unknown protein		Potri.016G105000 [exp]	4.69	0.7518
AT5G51990	AP2_ERF	CBF4, DREB1D	DEHYDRATION-RESPONSIVE ELEMENT...		Potri.012G134100 [exp]	5.91	0.8588
					Potri.009G076050 [exp]	19.44	0.7845
AT4G25810		XTH23, XTR6	xyloglucan endotransglucosylas...		Potri.018G094900 [exp]	21.44	0.7825
AT4G25810		XTH23, XTR6	xyloglucan endotransglucosylas...		Potri.018G095200 [exp]	23.36	0.8752	EXT.7
AT3G14470			NB-ARC domain-containing disea...		Potri.017G133600 [exp]	23.49	0.8196
AT5G25810	AP2_ERF	TNY, TINY	TINY, Integrase-type DNA-bindi...		Potri.019G067400 [exp]	24.73	0.7642
AT4G25810		XTH23, XTR6	xyloglucan endotransglucosylas...		Potri.018G095100 [exp]	27.64	0.8737	EXT.8

Compare expression of checked genes

Potri.005G201250 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.