Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G30933 140 / 8e-41 Carbohydrate-binding X8 domain superfamily protein (.1.2) AT1G29380 125 / 3e-34 Carbohydrate-binding X8 domain superfamily protein (.1) AT1G09460 110 / 4e-28 Carbohydrate-binding X8 domain superfamily protein (.1) AT5G55180 105 / 1e-25 O-Glycosyl hydrolases family 17 protein (.1.2) AT4G05430 98 / 2e-25 Carbohydrate-binding X8 domain superfamily protein (.1) AT4G13600 99 / 1e-24 Carbohydrate-binding X8 domain superfamily protein (.1) AT2G05790 99 / 1e-23 O-Glycosyl hydrolases family 17 protein (.1) AT4G26830 99 / 2e-23 O-Glycosyl hydrolases family 17 protein (.1) AT5G67460 97 / 3e-23 O-Glycosyl hydrolases family 17 protein (.1) AT5G35740 90 / 1e-22 Carbohydrate-binding X8 domain superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G059600 [exp] 263 / 1e-88 AT2G30933 164 / 5e-50 Carbohydrate-binding X8 domain superfamily protein (.1.2) Potri.001G353400 [exp] 147 / 1e-42 AT1G29380 144 / 1e-40 Carbohydrate-binding X8 domain superfamily protein (.1) Potri.011G078500 [exp] 131 / 2e-36 AT1G29380 154 / 1e-44 Carbohydrate-binding X8 domain superfamily protein (.1) Potri.005G003500 [exp] 128 / 1e-33 AT2G30933 142 / 1e-38 Carbohydrate-binding X8 domain superfamily protein (.1.2) Potri.013G003500 [exp] 121 / 3e-31 AT1G09460 144 / 3e-38 Carbohydrate-binding X8 domain superfamily protein (.1) Potri.019G007800 [exp] 100 / 8e-26 AT4G05430 160 / 4e-51 Carbohydrate-binding X8 domain superfamily protein (.1) Potri.019G012000 [exp] 100 / 1e-25 AT4G05430 155 / 3e-49 Carbohydrate-binding X8 domain superfamily protein (.1) Potri.011G094400 [exp] 103 / 3e-25 AT5G55180 635 / 0.0 O-Glycosyl hydrolases family 17 protein (.1.2) Potri.001G315700 [exp] 99 / 6e-25 AT4G13600 155 / 2e-47 Carbohydrate-binding X8 domain superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10007342 [exp] 177 / 1e-54 AT2G30933 167 / 4e-51 Carbohydrate-binding X8 domain superfamily protein (.1.2) Lus10020765 [exp] 165 / 1e-49 AT2G30933 169 / 4e-52 Carbohydrate-binding X8 domain superfamily protein (.1.2) Lus10004546 [exp] 144 / 5e-41 AT1G29380 175 / 2e-52 Carbohydrate-binding X8 domain superfamily protein (.1) Lus10004600 [exp] 143 / 6e-41 AT1G29380 168 / 7e-50 Carbohydrate-binding X8 domain superfamily protein (.1) Lus10015259 [exp] 131 / 8e-37 AT1G29380 143 / 4e-41 Carbohydrate-binding X8 domain superfamily protein (.1) Lus10025379 [exp] 127 / 3e-35 AT1G29380 140 / 1e-39 Carbohydrate-binding X8 domain superfamily protein (.1) Lus10001516 [exp] 124 / 4e-33 AT2G30933 143 / 3e-40 Carbohydrate-binding X8 domain superfamily protein (.1.2) Lus10031443 [exp] 118 / 2e-30 AT2G30933 143 / 2e-40 Carbohydrate-binding X8 domain superfamily protein (.1.2) Lus10032601 [exp] 99 / 3e-25 AT4G13600 167 / 2e-52 Carbohydrate-binding X8 domain superfamily protein (.1) Lus10002466 [exp] 98 / 1e-24 AT5G67460 175 / 1e-53 O-Glycosyl hydrolases family 17 protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF07983 [poplar] [flax] X8 X8 domain
Representative CDS sequence Show only first row Show all	>Potri.005G202400.3 pacid=42805674 polypeptide=Potri.005G202400.3.p locus=Potri.005G202400 ID=Potri.005G202400.3.v4.1 annot-version=v4.1 ATGGGTGGCAGAGTCATCTACTCCCTAATGTTTTGCTTACTCGGTCTCTTCCTTTCTTCATCAGGTTCAAGTGTTACAAAAAGGTCAGCAAATGAGAATA GTGAACGAGCAGGCCATGGATCAAAACAGGTTGTAGTCCTTGTGAATTCTATTTCCGGCAGCCAAAAGGACATCACAACCCCGATAACCACTGTTCCCAC AATAATTCCCACCACATCGACTCCCCTGATAAACCCAAATTCAGACCCCGATTCCACATCGCCCGCTACCATTACGCCAATGGTAACCCCAACGTCAACA ACAACACCTGTGTCTCCAGGAGCTAGCTGGTGTATTGCTAGCCCAAGTGCATCACCAACAGCGTTACAAGTTGCTTTGGATTATGCTTGTGGCTATGGCG GTGCTGATTGCTCAGCAATTCTACCTAGTGGAAGCTGTTACAATCCAAACACTGTTCATGACCATGCCTCCTATGCATTCAACAGCTATTATCAGAAGAA TCCAGTGCCTAGTAGCTGTAATTTTGGAGGAACTGCTGCTACTACTAGCACTAATCCAAGTACTGGGACATGTCAGTTTCCTTCCACTAGCACAAGCTCG TCGGTCTTGAACACAACAAACTCAAATGGCGCAACTGTTTATGGTGCAGTGCCTTCGAATCCTGCCCCATCGGTAGCTACCAAAATTAACGAGAAACCAC ATTTTATGTCTCTGACATTTGTAGATGGTGCTATACTGATCTGTTGCTTGCCCTGCTTGCTAGCTAGTCTATGCTTTTTAGAAGACTAG
AA sequence Show only first row Show all	>Potri.005G202400.3 pacid=42805674 polypeptide=Potri.005G202400.3.p locus=Potri.005G202400 ID=Potri.005G202400.3.v4.1 annot-version=v4.1 MGGRVIYSLMFCLLGLFLSSSGSSVTKRSANENSERAGHGSKQVVVLVNSISGSQKDITTPITTVPTIIPTTSTPLINPNSDPDSTSPATITPMVTPTST TTPVSPGASWCIASPSASPTALQVALDYACGYGGADCSAILPSGSCYNPNTVHDHASYAFNSYYQKNPVPSSCNFGGTAATTSTNPSTGTCQFPSTSTSS SVLNTTNSNGATVYGAVPSNPAPSVATKINEKPHFMSLTFVDGAILICCLPCLLASLCFLED

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G30933			Carbohydrate-binding X8 domain...		Potri.005G202400 [exp]	0	1
AT1G23220			Dynein light chain type 1 fami...		Potri.008G133000 [exp]	2.23	0.8188
AT5G45030			Trypsin family protein (.1.2)		Potri.011G143200 [exp]	2.23	0.7711
AT3G18280			Bifunctional inhibitor/lipid-t...		Potri.015G044500 [exp]	4.89	0.7705
AT3G61920			unknown protein		Potri.014G104900 [exp]	5.29	0.8045
AT5G05830			RING/FYVE/PHD zinc finger supe...		Potri.009G039700 [exp]	5.74	0.7910
AT3G53850			Uncharacterised protein family...		Potri.006G090400 [exp]	6.48	0.7350
AT3G10980		SAG20, WI12, AT...	PLAC8 family protein (.1)		Potri.016G129700 [exp]	12.72	0.7106
AT3G18280			Bifunctional inhibitor/lipid-t...		Potri.012G054300 [exp]	12.84	0.7241
AT3G56810			unknown protein		Potri.016G024600 [exp]	12.96	0.7675
AT4G32785			unknown protein		Potri.018G042000 [exp]	14.07	0.7510

Compare expression of checked genes

Potri.005G202400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.