Potri.005G202500 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G06320 74 / 7e-17 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10038213 54 / 1e-09 AT1G06320 56 / 5e-10 unknown protein
PFAM info
Representative CDS sequence
>Potri.005G202500.1 pacid=42803277 polypeptide=Potri.005G202500.1.p locus=Potri.005G202500 ID=Potri.005G202500.1.v4.1 annot-version=v4.1
ATGAGCAAGATTTCTCTCGAAGATTATCTCCATTTTTTTCTATCTCACAAGCAATTCGGTCTCTCCCCCAATTTCCTCAATCAGATTATTCGCATGCACG
GCTTCAAGAAAATCGATAAAAAGGTGTTGATAGATGCGGTGGATAAAATAGATCTGGAGAATCTGTCACGCTCCACAGTGAAAGAGAAAAACGAAATATC
GTCATGCACATTGATGAACATGGAGGACATCGTGGCGGACATGAAGAAGCTCGACTGGCAGGAGTGCCGCGTCACTTCCATCCAATCACTCAACGCAAAA
TCAGATCTCCAAGGTGTAGCTGGAGGAGGAGGCAAAAGGAAGAGGAAGAGGAAGAGAGGTAGTAGCAGTGCAAGAGGTGCTGCTGCTGCTATTGATGCTC
TATCTACTACTACGGCTCTTGTTTGA
AA sequence
>Potri.005G202500.1 pacid=42803277 polypeptide=Potri.005G202500.1.p locus=Potri.005G202500 ID=Potri.005G202500.1.v4.1 annot-version=v4.1
MSKISLEDYLHFFLSHKQFGLSPNFLNQIIRMHGFKKIDKKVLIDAVDKIDLENLSRSTVKEKNEISSCTLMNMEDIVADMKKLDWQECRVTSIQSLNAK
SDLQGVAGGGGKRKRKRKRGSSSARGAAAAIDALSTTTALV

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G06320 unknown protein Potri.005G202500 0 1
AT5G67500 VDAC2, ATVDAC2 ARABIDOPSIS THALIANA VOLTAGE D... Potri.001G294000 2.23 0.8013
AT4G34270 TIP41-like family protein (.1) Potri.009G093200 6.00 0.7652
AT4G22820 A20/AN1-like zinc finger famil... Potri.012G130100 6.24 0.7738
AT4G21740 unknown protein Potri.011G095000 7.21 0.8017
AT1G07410 ATRAB-A2B, AtRA... ARABIDOPSIS RAB GTPASE HOMOLOG... Potri.006G000300 8.12 0.8296 RAB11.6
AT1G75150 unknown protein Potri.002G262800 14.24 0.7837
AT1G43890 ATRAB-C1, RAB18... RAB GTPASE HOMOLOG 18-1, ARABI... Potri.002G074400 15.96 0.7686
AT3G51770 ATEOL1, ETO1 ARABIDOPSIS ETHYLENE OVERPRODU... Potri.006G103400 22.44 0.7565
AT2G18670 RING/U-box superfamily protein... Potri.018G098100 23.87 0.7450
AT1G17890 GER2 NAD(P)-binding Rossmann-fold s... Potri.006G179100 24.59 0.7371

Potri.005G202500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.