Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G43000 268 / 1e-89 NAC ANAC042, JUB1, JUNGBRUNNEN1 NAC domain containing protein 42 (.1) AT3G12910 235 / 4e-76 NAC NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) AT5G39820 227 / 1e-72 NAC ANAC094 NAC domain containing protein 94 (.1) AT1G26870 211 / 3e-65 NAC FEZ, ANAC009 FEZ, Arabidopsis NAC domain containing protein 9, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) AT2G02450 182 / 2e-54 NAC LOV1, ANAC034, ANAC035 LONG VEGETATIVE PHASE 1, Arabidopsis NAC domain containing protein 34, NAC domain containing protein 35 (.1.2) AT3G04070 169 / 4e-50 NAC ANAC047 NAC domain containing protein 47 (.1.2) AT5G08790 166 / 1e-49 NAC ATAF2, ANAC081 Arabidopsis NAC domain containing protein 81, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) AT1G69490 165 / 2e-49 NAC NAP, ANAC029, ATNAP Arabidopsis NAC domain containing protein 29, NAC-like, activated by AP3/PI (.1) AT5G63790 165 / 9e-49 NAC ANAC102 NAC domain containing protein 102 (.1) AT1G12260 164 / 8e-48 NAC ANAC007, VND4, EMB2749 VASCULAR RELATED NAC-DOMAIN PROTEIN 4, EMBRYO DEFECTIVE 2749, NAC 007 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G057200 [exp] 469 / 1e-168 AT2G43000 282 / 4e-95 NAC domain containing protein 42 (.1) Potri.001G080900 [exp] 305 / 1e-103 AT2G43000 257 / 3e-85 NAC domain containing protein 42 (.1) Potri.007G066300 [exp] 298 / 5e-101 AT3G12910 269 / 2e-89 NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Potri.005G098000 [exp] 287 / 2e-96 AT3G12910 271 / 2e-90 NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Potri.003G149700 [exp] 286 / 2e-96 AT2G43000 245 / 2e-80 NAC domain containing protein 42 (.1) Potri.004G126901 [exp] 227 / 9e-72 AT5G39820 305 / 1e-101 NAC domain containing protein 94 (.1) Potri.017G082000 [exp] 225 / 3e-71 AT1G26870 299 / 3e-98 FEZ, Arabidopsis NAC domain containing protein 9, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Potri.003G046700 [exp] 177 / 8e-53 AT2G02450 318 / 2e-106 LONG VEGETATIVE PHASE 1, Arabidopsis NAC domain containing protein 34, NAC domain containing protein 35 (.1.2) Potri.019G031400 [exp] 170 / 3e-50 AT3G04070 332 / 1e-112 NAC domain containing protein 47 (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031189 [exp] 251 / 2e-81 AT3G12910 264 / 9e-87 NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Lus10031767 [exp] 228 / 1e-74 AT2G43000 236 / 3e-78 NAC domain containing protein 42 (.1) Lus10030478 [exp] 233 / 9e-74 AT5G39820 297 / 4e-98 NAC domain containing protein 94 (.1) Lus10038332 [exp] 228 / 1e-73 AT2G43000 231 / 1e-75 NAC domain containing protein 42 (.1) Lus10036194 [exp] 224 / 3e-72 AT3G12910 224 / 1e-72 NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Lus10015367 [exp] 220 / 8e-70 AT1G26870 298 / 8e-99 FEZ, Arabidopsis NAC domain containing protein 9, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Lus10007263 [exp] 218 / 1e-68 AT5G39820 300 / 3e-100 NAC domain containing protein 94 (.1) Lus10036749 [exp] 219 / 3e-68 AT1G26870 306 / 4e-100 FEZ, Arabidopsis NAC domain containing protein 9, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Lus10037178 [exp] 219 / 7e-68 AT5G39820 306 / 3e-101 NAC domain containing protein 94 (.1) Lus10006547 [exp] 175 / 8e-52 AT3G04070 337 / 4e-114 NAC domain containing protein 47 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02365 [poplar] [flax] NAM No apical meristem (NAM) protein
Representative CDS sequence Show only first row Show all	>Potri.005G205400.1 pacid=42804995 polypeptide=Potri.005G205400.1.p locus=Potri.005G205400 ID=Potri.005G205400.1.v4.1 annot-version=v4.1 ATGGAGGCCATGACAAAGATGAGTGGCTGTATTAGTTCTGATAATTATGATAAGGATGAGGAAGTGATACTTCCGGGTTTCCGATTTCACCCCACAGATG AAGAGCTTGTTGGGTTCTATCTGCGGCGGAAGGTGGAAAAGAAACGAATTGGTATTGAACTCATCAAACAGATTGATATCTACAAATACGATCCATGGGA TCTTCCAATTAGCACTGCAGAGGACAAAGAGTGGTATTTCTTCTGCTTAAGAGGGAGAAAGTACAGGAACAGCGTAAGACCTAATAGGGTGACACGATCT GGATTTTGGAAGGCCACTGGTATTGACAAGCCCATATATTCAGACAAAGAAACACATGAGTGCATCGGTCTCAAGAAATGCTTGGTATACTACCGGGGAA GTGCTGGAAAAGGCACAAAAACTGATTGGATGATGCATGAATTTCGCCTTCCACCAAACGGGAAGACTACAAATCCCCTCAACGCTAGGAACATTGCGCA AGAAGCTGAGGTTTGGACACTCTGTCGAATTCTGAAACGAATCCCATCCTACAAAAAGTACGTAGCTGCAGTACCAGCAACTGAACAAAAACCCATTAAC TGTGATTCAAATTCAAAATCATGCAGCTTTGAATCTGAAACCAGTACTGAGCAGGATGTAAGTTTTGGAGACTCATTTGTTCAAAGAAATGAAAGGAAGC CTGTCACCATAGACCAAGTTGACCATGAAAGGAATAACCTTTTTATGGGTGGTCAATATGATTCAGTAACTGAAGCTCCATTTACAGCAGCTTACCAGGG CTTTCGGAACACAGGTATTGGAGATGATTTCTTCGTTAATGGAAACTGGGATGACCTAAGAACAGTGGTTGAGCTAGCCATCGATCCAGCTCAAGTTCCT GACGAATGTAGATGGTAG
AA sequence Show only first row Show all	>Potri.005G205400.1 pacid=42804995 polypeptide=Potri.005G205400.1.p locus=Potri.005G205400 ID=Potri.005G205400.1.v4.1 annot-version=v4.1 MEAMTKMSGCISSDNYDKDEEVILPGFRFHPTDEELVGFYLRRKVEKKRIGIELIKQIDIYKYDPWDLPISTAEDKEWYFFCLRGRKYRNSVRPNRVTRS GFWKATGIDKPIYSDKETHECIGLKKCLVYYRGSAGKGTKTDWMMHEFRLPPNGKTTNPLNARNIAQEAEVWTLCRILKRIPSYKKYVAAVPATEQKPIN CDSNSKSCSFESETSTEQDVSFGDSFVQRNERKPVTIDQVDHERNNLFMGGQYDSVTEAPFTAAYQGFRNTGIGDDFFVNGNWDDLRTVVELAIDPAQVP DECRW

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G43000	NAC	ANAC042, JUB1, ...	NAC domain containing protein ...		Potri.005G205400 [exp]	0	1
AT1G02260			Divalent ion symporter (.1)		Potri.017G141950 [exp]	1.41	0.9760
AT3G21750		UGT71B1	UDP-glucosyl transferase 71B1 ...		Potri.016G017100 [exp]	1.73	0.9703
AT4G15350		CYP705A2	"cytochrome P450, family 705, ...		Potri.009G066200 [exp]	3.46	0.9656
AT3G60690			SAUR-like auxin-responsive pro...		Potri.002G145300 [exp]	5.19	0.9558	SAUR20
AT3G20140		CYP705A23	"cytochrome P450, family 705, ...		Potri.009G066300 [exp]	5.65	0.9507
AT2G29120		ATGLR2.7	GLUTAMATE RECEPTOR 2.7, gluta...		Potri.011G062600 [exp]	6.48	0.9610
AT1G02260			Divalent ion symporter (.1)		Potri.017G141800 [exp]	6.63	0.9551
AT1G76430		PHT1;9	phosphate transporter 1;9 (.1)		Potri.005G256100 [exp]	9.79	0.9606	11
AT1G76360			Protein kinase superfamily pro...		Potri.002G009400 [exp]	10.00	0.9553
AT3G21760		HYR1	HYPOSTATIN RESISTANCE 1, UDP-G...		Potri.016G017166 [exp]	10.24	0.9511

Compare expression of checked genes

Potri.005G205400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.