Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	Pt-RPS12.3
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G32060 201 / 2e-67 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1.2.3) AT1G15930 197 / 7e-66 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G056200 [exp] 275 / 7e-97 AT2G32060 201 / 9e-68 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1.2.3) Potri.003G181200 [exp] 230 / 3e-79 AT2G32060 188 / 1e-62 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1.2.3) Potri.001G046600 [exp] 228 / 3e-78 AT2G32060 194 / 8e-65 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1.2.3)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021027 [exp] 235 / 8e-81 AT2G32060 192 / 4e-64 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1.2.3) Lus10027800 [exp] 234 / 1e-80 AT2G32060 197 / 3e-66 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1.2.3) Lus10035501 [exp] 223 / 6e-72 AT3G12150 333 / 3e-111 unknown protein Lus10023825 [exp] 207 / 1e-68 AT2G32060 168 / 3e-53 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1.2.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0101 [poplar] [flax] PELOTA PF01248 [poplar] [flax] Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Representative CDS sequence Show only first row Show all	>Potri.005G206300.1 pacid=42805365 polypeptide=Potri.005G206300.1.p locus=Potri.005G206300 ID=Potri.005G206300.1.v4.1 annot-version=v4.1 ATGTCAGGTGAAGAAGGTGCTGTTCCTCAGAATGAGACTCCAGCTGTTGCTGATGCACCCGCACCCCTCGGTGAGCCAATGGACTTGATGACAGCATTGC AGCTTGTTCTGAGAAAATCACTTGCTCATGGTGGGCTTTCTCGAGGGCTTCATGAAGGGGCCAAAATGATTGAGAAGCATACTGCTCAACTTTGTGTCTT GGCCGAGGATTGTAACCAACCTGACTATGTCAAACTTGTTAAGGCACTTTGTGCTGACCACAAAGTGAACTTGCTATCTGTTCCAAGCGCAAAGACCCTA GGAGAGTGGGCTGGTTTGTGCAAGATTGATTCAGAGGGGAAGGCCAGGAAAGTAGTTGGTTGCTCTTGCGTTGTTGTGAAGGATTTTGGAGAGGACAGTG AAGCTCTTAATGTTGTCCAACAGCATATCAAAGCTAACTAA
AA sequence Show only first row Show all	>Potri.005G206300.1 pacid=42805365 polypeptide=Potri.005G206300.1.p locus=Potri.005G206300 ID=Potri.005G206300.1.v4.1 annot-version=v4.1 MSGEEGAVPQNETPAVADAPAPLGEPMDLMTALQLVLRKSLAHGGLSRGLHEGAKMIEKHTAQLCVLAEDCNQPDYVKLVKALCADHKVNLLSVPSAKTL GEWAGLCKIDSEGKARKVVGCSCVVVKDFGEDSEALNVVQQHIKAN

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G32060			Ribosomal protein L7Ae/L30e/S1...		Potri.005G206300 [exp]	0	1	Pt-RPS12.3
AT3G02560			Ribosomal protein S7e family p...		Potri.006G087900 [exp]	1.73	0.9445
AT3G59540			Ribosomal L38e protein family ...		Potri.007G131800 [exp]	2.64	0.9592
AT5G62300			Ribosomal protein S10p/S20e fa...		Potri.015G129800 [exp]	5.19	0.9350	RPS20.2
AT4G25740			RNA binding Plectin/S10 domain...		Potri.004G073500 [exp]	7.34	0.9557
AT5G45775			Ribosomal L5P family protein (...		Potri.011G068900 [exp]	10.90	0.9361	Pt-L16.1
AT5G27700			Ribosomal protein S21e (.1)		Potri.005G026000 [exp]	10.95	0.9418
AT5G24510			60S acidic ribosomal protein f...		Potri.012G021700 [exp]	10.95	0.9357
AT3G56340			Ribosomal protein S26e family ...		Potri.019G057000 [exp]	13.22	0.9414	RPS26.2
AT5G02960			Ribosomal protein S12/S23 fami...		Potri.016G085800 [exp]	15.29	0.9401	Pt-RPS23.5
AT5G51960			unknown protein		Potri.008G044200 [exp]	15.87	0.9115

Compare expression of checked genes

Potri.005G206300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.