Plant FIBer expression Database

OM14.1 (Potri.005G208100) [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol OM14.1
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G52420 52 / 1e-10 ATOEP7 outer envelope membrane protein 7 (.1)
AT5G19151 41 / 2e-06 unknown protein
AT3G63160 36 / 0.0003 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G054700
[exp]
84 / 2e-23 AT3G52420 49 / 1e-09 outer envelope membrane protein 7 (.1)
Potri.017G127350
[exp]
73 / 5e-19 AT3G52420 53 / 4e-11 outer envelope membrane protein 7 (.1)
Potri.008G203800
[exp]
39 / 2e-05 AT5G19151 54 / 2e-11 unknown protein
Potri.011G084300
[exp]
35 / 0.0005 AT2G34585 77 / 9e-21 unknown protein
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10003733
[exp]
66 / 5e-16 AT3G52420 68 / 5e-17 outer envelope membrane protein 7 (.1)
Lus10034040
[exp]
40 / 2e-05 AT5G19151 58 / 9e-13 unknown protein
PFAM info
Representative CDS sequence
>Potri.005G208100.1 pacid=42802545 polypeptide=Potri.005G208100.1.p locus=Potri.005G208100 ID=Potri.005G208100.1.v4.1 annot-version=v4.1
ATGGGGATGAAGCCAGCGAAACAGGCGGCGGTTGTATTTGGGGCTCTTGCATTTGGGTGGCTAGCTATTGAGATGGCTTTCAAACCCTTCCTCGACAAGG
CTCGTTCCGCCATGGACAAGTCTGATCCTGCTCGGGATCCCGATGGTGATGATGATTCTGCTGATCGCAAGGAGAAGGGCTCCCTCTCTGAATCTGGTGC
TTTTTTCTCTGATGAGAACCCAGCAGTTGCTTGA
AA sequence
>Potri.005G208100.1 pacid=42802545 polypeptide=Potri.005G208100.1.p locus=Potri.005G208100 ID=Potri.005G208100.1.v4.1 annot-version=v4.1
MGMKPAKQAAVVFGALAFGWLAIEMAFKPFLDKARSAMDKSDPARDPDGDDDSADRKEKGSLSESGAFFSDENPAVA

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G52420 ATOEP7 outer envelope membrane protei... Potri.005G208100
[exp]
0 1 OM14.1
AT5G09250 KIWI ssDNA-binding transcriptional ... Potri.007G101100
[exp]
1.00 0.7979 KIWI.1
AT5G55160 ATSUMO2, SUMO2,... small ubiquitin-like modifier ... Potri.014G158300
[exp]
1.41 0.7841 SMT3.2
AT1G61700 RNA polymerases N / 8 kDa subu... Potri.003G102900
[exp]
5.91 0.6969
AT2G04520 Nucleic acid-binding, OB-fold-... Potri.002G031700
[exp]
22.97 0.7320
AT3G57062 unknown protein Potri.006G041600
[exp]
23.83 0.6959
AT1G74520 ATHVA22A HVA22 homologue A (.1) Potri.017G139000
[exp]
24.71 0.6843
AT5G06080 AS2 LBD33 LOB domain-containing protein ... Potri.010G200400
[exp]
25.82 0.6672 LBD33.1
AT2G04520 Nucleic acid-binding, OB-fold-... Potri.002G219200
[exp]
26.98 0.6177
AT5G20570 HRT1, ROC1, RBX... REGULATOR OF CULLINS-1, RING-b... Potri.001G167400
[exp]
30.51 0.6415
AT3G21670 Major facilitator superfamily ... Potri.002G225500
[exp]
30.72 0.7188

Potri.005G208100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.