Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G48540 52 / 1e-08 receptor-like protein kinase-related family protein (.1) AT4G23140 46 / 2e-06 RLK5, CRK6 cysteine-rich RLK (RECEPTOR-like protein kinase) 6 (.1), cysteine-rich RLK (RECEPTOR-like protein kinase) 6 (.2) AT2G31620 44 / 1e-05 Receptor-like protein kinase-related family protein (.1) AT4G05200 44 / 2e-05 CRK25 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1) AT3G45860 41 / 9e-05 CRK4 cysteine-rich RLK (RECEPTOR-like protein kinase) 4 (.1) AT3G22060 40 / 0.0001 Receptor-like protein kinase-related family protein (.1) AT3G58310 40 / 0.0002 Domain of unknown function (DUF26) (.1) AT4G23280 40 / 0.0002 CRK20 cysteine-rich RLK (RECEPTOR-like protein kinase) 20 (.1) AT4G23170 40 / 0.0002 CRK9, EP1 CYSTEINE-RICH RLK \(RECEPTOR-LIKE PROTEIN KINASE\) 9, receptor-like protein kinase-related family protein (.1) AT1G70690 40 / 0.0003 HWI1, PDLP5 PLASMODESMATA-LOCATED PROTEIN 5, HOPW1-1-INDUCED GENE1, Receptor-like protein kinase-related family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G030650 [exp] 57 / 2e-10 AT4G05200 476 / 1e-159 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1) Potri.004G023700 [exp] 53 / 7e-09 AT4G05200 474 / 3e-159 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1) Potri.004G024140 [exp] 50 / 9e-08 AT4G23180 497 / 3e-168 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) Potri.004G023876 [exp] 50 / 1e-07 AT4G23180 489 / 5e-165 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) Potri.004G024000 [exp] 49 / 2e-07 AT4G23180 489 / 4e-165 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) Potri.004G024900 [exp] 47 / 6e-07 AT4G23180 506 / 1e-171 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) Potri.004G025900 [exp] 47 / 6e-07 AT4G23130 573 / 0.0 RECEPTOR-LIKE PROTEIN KINASE 6, cysteine-rich RLK (RECEPTOR-like protein kinase) 5 (.1), cysteine-rich RLK (RECEPTOR-like protein kinase) 5 (.2) Potri.007G120600 [exp] 47 / 6e-07 AT3G22060 214 / 2e-69 Receptor-like protein kinase-related family protein (.1) Potri.007G120601 [exp] 45 / 2e-06 AT3G22060 199 / 9e-65 Receptor-like protein kinase-related family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028026 [exp] 146 / 6e-46 AT4G23290 44 / 1e-05 cysteine-rich RLK (RECEPTOR-like protein kinase) 21 (.1), cysteine-rich RLK (RECEPTOR-like protein kinase) 21 (.2) Lus10003735 [exp] 130 / 1e-39 AT4G23210 43 / 3e-05 cysteine-rich RLK (RECEPTOR-like protein kinase) 13 (.1), cysteine-rich RLK (RECEPTOR-like protein kinase) 13 (.2), cysteine-rich RLK (RECEPTOR-like protein kinase) 13 (.3) Lus10011894 [exp] 61 / 2e-12 AT3G60720 38 / 9e-04 plasmodesmata-located protein 8 (.1) Lus10022828 [exp] 60 / 6e-12 AT2G01660 43 / 2e-05 plasmodesmata-located protein 6 (.1.2) Lus10007631 [exp] 57 / 3e-10 AT4G23180 257 / 1e-76 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1) Lus10007504 [exp] 56 / 3e-10 AT3G22040 42 / 3e-05 Domain of unknown function (DUF26) (.1) Lus10026169 [exp] 55 / 4e-10 AT4G05200 51 / 4e-08 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1) Lus10008656 [exp] 53 / 1e-09 AT4G05200 44 / 8e-06 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1) Lus10028980 [exp] 54 / 2e-09 AT3G21945 39 / 9e-04 Receptor-like protein kinase-related family protein (.1) Lus10026168 [exp] 53 / 3e-09 ND 37 / 0.005
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01657 [poplar] [flax] Stress-antifung Salt stress response/antifungal
Representative CDS sequence Show only first row Show all	>Potri.005G208400.1 pacid=42803219 polypeptide=Potri.005G208400.1.p locus=Potri.005G208400 ID=Potri.005G208400.1.v4.1 annot-version=v4.1 ATGAAGAGAACAAGAAACATGGGTTTTCCTCCAAAACTGGCCCTGGTTTTCATCGGATTCTTTGGATGGTGCGTCATTGCTACAAGTGTTCCTGATACCA ACGTGACAACTGTTCTCTGCAACTCAGGGGTGTACTCAAAGGGTGATCCTTTTGGTACTAGTCTAGCTTATGTCCTTGCAGAAATTGAGGCTGTAACCCC AACGAGCAAGAATTATGACTACTTCAACATCTCTCCTTATCCTAATGCTGTTGCCTATGGTCATGCTGCTTGTAATCAGAACCTCACCAGCTCCGACTGC TCATCATGTCTTGGTACGGCTAAAACAGCCATGTTTGCGAGTTGTCAAAGCCGAATAGGGGCTCGTTCGGTGCTCCATGATTGTACGATTAGGTATGAGC AATACCCATTTTCTGATTAA
AA sequence Show only first row Show all	>Potri.005G208400.1 pacid=42803219 polypeptide=Potri.005G208400.1.p locus=Potri.005G208400 ID=Potri.005G208400.1.v4.1 annot-version=v4.1 MKRTRNMGFPPKLALVFIGFFGWCVIATSVPDTNVTTVLCNSGVYSKGDPFGTSLAYVLAEIEAVTPTSKNYDYFNISPYPNAVAYGHAACNQNLTSSDC SSCLGTAKTAMFASCQSRIGARSVLHDCTIRYEQYPFSD

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G48540			receptor-like protein kinase-r...		Potri.005G208400 [exp]	0	1
AT3G59470	FAR1_related		Far-red impaired responsive (F...		Potri.008G076800 [exp]	90.12	0.5548
AT1G02816			Protein of unknown function, D...		Potri.014G127600 [exp]	91.48	0.5198
AT3G06170			Serinc-domain containing serin...		Potri.008G201900 [exp]	148.14	0.5382
AT5G44670			Domain of unknown function (DU...		Potri.001G074600 [exp]	190.83	0.5245
AT5G58005			Cytochrome c oxidase, subunit ...		Potri.006G186500 [exp]	197.74	0.5223
AT4G25780			CAP (Cysteine-rich secretory p...		Potri.018G096028 [exp]	199.46	0.5097
AT3G08890			Protein of unknown function, D...		Potri.016G125300 [exp]	202.21	0.4980
AT3G56130			biotin/lipoyl attachment domai...		Potri.010G183200 [exp]	235.52	0.5021
AT4G36195			Serine carboxypeptidase S28 fa...		Potri.007G015300 [exp]	280.48	0.4978

Compare expression of checked genes

Potri.005G208400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.