Potri.005G209800 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G63120 223 / 5e-74 CYCP1;1 cyclin p1;1 (.1)
AT2G44740 176 / 1e-55 CYCP4;1 cyclin p4;1 (.1)
AT3G05327 176 / 2e-55 Cyclin family protein (.1)
AT5G07450 158 / 1e-48 CYCP4;3 cyclin p4;3 (.1)
AT5G61650 155 / 2e-47 CYCP4;2 CYCLIN P4;2 (.1)
AT3G60550 153 / 2e-46 CYCP3;2 cyclin p3;2 (.1)
AT2G45080 151 / 1e-45 CYCP3;1 cyclin p3;1 (.1)
AT3G21870 147 / 4e-44 CYCP2;1 cyclin p2;1 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G052800 406 / 6e-146 AT3G63120 219 / 1e-71 cyclin p1;1 (.1)
Potri.013G023000 228 / 5e-76 AT3G05327 194 / 4e-63 Cyclin family protein (.1)
Potri.005G033600 223 / 6e-74 AT3G05327 184 / 5e-59 Cyclin family protein (.1)
Potri.015G112140 176 / 2e-55 AT2G44740 274 / 1e-94 cyclin p4;1 (.1)
Potri.014G050400 175 / 2e-55 AT2G44740 285 / 8e-99 cyclin p4;1 (.1)
Potri.012G114600 171 / 1e-53 AT2G44740 277 / 2e-95 cyclin p4;1 (.1)
Potri.007G121500 166 / 1e-51 AT3G21870 228 / 5e-76 cyclin p2;1 (.1)
Potri.002G143400 147 / 6e-44 AT2G45080 324 / 1e-113 cyclin p3;1 (.1)
Potri.014G066400 146 / 1e-43 AT3G60550 343 / 3e-121 cyclin p3;2 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10022038 320 / 6e-112 AT3G63120 197 / 8e-64 cyclin p1;1 (.1)
Lus10042582 316 / 2e-110 AT3G63120 191 / 2e-61 cyclin p1;1 (.1)
Lus10029933 198 / 4e-64 AT3G05327 172 / 3e-54 Cyclin family protein (.1)
Lus10004475 197 / 9e-64 AT3G05327 171 / 1e-53 Cyclin family protein (.1)
Lus10032505 166 / 2e-51 AT2G44740 228 / 7e-76 cyclin p4;1 (.1)
Lus10043003 166 / 4e-51 AT2G44740 227 / 2e-75 cyclin p4;1 (.1)
Lus10039697 154 / 8e-47 AT3G21870 236 / 3e-79 cyclin p2;1 (.1)
Lus10027148 154 / 3e-46 AT3G21870 233 / 6e-77 cyclin p2;1 (.1)
Lus10042873 147 / 5e-44 AT3G60550 300 / 8e-104 cyclin p3;2 (.1)
Lus10028174 131 / 3e-38 AT2G45080 249 / 1e-84 cyclin p3;1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0065 Cyclin PF00134 Cyclin_N Cyclin, N-terminal domain
Representative CDS sequence
>Potri.005G209800.2 pacid=42805094 polypeptide=Potri.005G209800.2.p locus=Potri.005G209800 ID=Potri.005G209800.2.v4.1 annot-version=v4.1
ATGGAAGCTCTTTCACCTGATAGTGGAAGCATGGACTCGGATATCTATCGAACCTTGGGACTTGAGGAATTAAGAAAAGGAGTTTTAAGATCTCCTAGGG
TTTTAATGCTTCTTTCTTCTCTTCTTGATAGATCTGTTCAAAAAAATGAAATGCTACTGGAGACAACGCAGATCAAAGATGTTGTTACCATATTTCATGG
CTTAAGACCACCTACTGTAAGTATCCGGAACTATGTTGATCGAATCTTCAAGTACTCTGCCTGCAGCCCGTCTTGCTTTGTTGTTGCACACATTTATATG
GATAGATTTCTCCAGCAAACAGATATTCATTTAACTGCCCTTAATGTTCACCGTCTCCTGATTACAAGTGTAATGATAGCAGCAAAGTTTGTAGATGATG
CCTTCTTTAACAATGCCTACTATGCCAAAGTTGGAGGAGTAAGCACAGAAGAATTGAACAGGTTGGAGATGAAGTTTTTGTTTAGTATAGATTTCAGACT
TCAAGTAAATGTCAATACATTTGGAAAACACTGTTATCAGCTGGAAAAAGAATCTGCCGGTGGGCTTCAGATTGAACGCCCAATCCAAGCATGTAGAATT
AAAGAAAGTTGGTCAAGCAAAGATGATTCAACTGCTTGTTCTTCCACGATTGCAAGATGA
AA sequence
>Potri.005G209800.2 pacid=42805094 polypeptide=Potri.005G209800.2.p locus=Potri.005G209800 ID=Potri.005G209800.2.v4.1 annot-version=v4.1
MEALSPDSGSMDSDIYRTLGLEELRKGVLRSPRVLMLLSSLLDRSVQKNEMLLETTQIKDVVTIFHGLRPPTVSIRNYVDRIFKYSACSPSCFVVAHIYM
DRFLQQTDIHLTALNVHRLLITSVMIAAKFVDDAFFNNAYYAKVGGVSTEELNRLEMKFLFSIDFRLQVNVNTFGKHCYQLEKESAGGLQIERPIQACRI
KESWSSKDDSTACSSTIAR

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G63120 CYCP1;1 cyclin p1;1 (.1) Potri.005G209800 0 1
AT3G47510 unknown protein Potri.013G066600 2.23 0.8151
AT4G16400 unknown protein Potri.006G017900 3.00 0.8292
AT4G38960 CO B-box type zinc finger family ... Potri.004G162600 4.47 0.8010
AT5G24760 GroES-like zinc-binding dehydr... Potri.004G067000 4.69 0.8415
AT5G43150 unknown protein Potri.003G187500 4.89 0.8144
AT3G13677 unknown protein Potri.001G406200 6.92 0.7754
AT1G23890 NHL domain-containing protein ... Potri.004G087300 8.12 0.7302
AT5G66050 Wound-responsive family protei... Potri.005G105900 8.48 0.8024
AT5G37600 ATGLN1;1, GLN1;... ARABIDOPSIS THALIANA GLUTAMINE... Potri.012G043900 8.71 0.8249 NCPGS.6
AT1G55530 RING/U-box superfamily protein... Potri.013G060500 9.48 0.8294

Potri.005G209800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.