Potri.005G211200 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G09800 276 / 5e-97 RPS18C S18 ribosomal protein (.1)
AT1G34030 276 / 5e-97 Ribosomal protein S13/S18 family (.1)
AT1G22780 276 / 5e-97 RPS18A, PFL1, PFL 40S RIBOSOMAL PROTEIN S18, POINTED FIRST LEAVES 1, POINTED FIRST LEAVES, Ribosomal protein S13/S18 family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G051300 282 / 2e-99 AT4G09800 275 / 2e-96 S18 ribosomal protein (.1)
Potri.005G196600 276 / 4e-96 AT4G09800 278 / 2e-96 S18 ribosomal protein (.1)
Potri.002G064632 136 / 2e-42 AT4G09800 151 / 7e-49 S18 ribosomal protein (.1)
Potri.002G088400 47 / 6e-07 AT1G77750 175 / 4e-56 Ribosomal protein S13/S18 family (.1)
Potri.005G172600 38 / 0.0009 AT5G14320 227 / 5e-77 EMBRYO DEFECTIVE 3137, Ribosomal protein S13/S18 family (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10042603 282 / 4e-99 AT1G22780 304 / 5e-108 40S RIBOSOMAL PROTEIN S18, POINTED FIRST LEAVES 1, POINTED FIRST LEAVES, Ribosomal protein S13/S18 family (.1)
Lus10006914 282 / 4e-99 AT4G09800 304 / 5e-108 S18 ribosomal protein (.1)
Lus10014676 281 / 8e-99 AT1G34030 303 / 1e-107 Ribosomal protein S13/S18 family (.1)
Lus10022057 281 / 8e-99 AT4G09800 303 / 1e-107 S18 ribosomal protein (.1)
Lus10034179 280 / 2e-98 AT1G34030 302 / 3e-107 Ribosomal protein S13/S18 family (.1)
Lus10043405 223 / 2e-76 AT1G34030 245 / 3e-85 Ribosomal protein S13/S18 family (.1)
PFAM info
Representative CDS sequence
>Potri.005G211200.1 pacid=42805537 polypeptide=Potri.005G211200.1.p locus=Potri.005G211200 ID=Potri.005G211200.1.v4.1 annot-version=v4.1
ATGTCGCTGGTAGCAAATGAGGAATTCCAACACATTCTTCGTGTTTTGAACACCAACGTTGATGGCAAACAGAAGATTATGTTTGCTCTTACATCCATTA
AAGGTATTGGTCGTCGTTTCGCCAACATTGTCTGCAAGAAGGCCGATGTAGACATGAACAAGAGAGCTGGTGAACTGTCAGCTGAGGAGCTTGACAAGCT
TATGACCATTGTTGCTAATCCTCGTCAGTTCAAGATTCCAGACTGGTTCCTTAACAGGCAGAAGGACTACAAAGATGGAAAGTACTCCCAGGTTGTTTCC
AATGCATTGGACATGAAGCTGAGAGATGATCTTGAGCGTTTGAAGAAGATCAGAAATCACCGTGGTCTCCGTCATTACTGGGGTCTCCGAGTGCGCGGGC
AGCACACCAAGACCACTGGCCGTAGGGGAAAGACTGTTGGTGTCTCCAAGAAGCGATGA
AA sequence
>Potri.005G211200.1 pacid=42805537 polypeptide=Potri.005G211200.1.p locus=Potri.005G211200 ID=Potri.005G211200.1.v4.1 annot-version=v4.1
MSLVANEEFQHILRVLNTNVDGKQKIMFALTSIKGIGRRFANIVCKKADVDMNKRAGELSAEELDKLMTIVANPRQFKIPDWFLNRQKDYKDGKYSQVVS
NALDMKLRDDLERLKKIRNHRGLRHYWGLRVRGQHTKTTGRRGKTVGVSKKR

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G09800 RPS18C S18 ribosomal protein (.1) Potri.005G211200 0 1
AT1G67430 Ribosomal protein L22p/L17e fa... Potri.015G094400 1.00 0.9861 RPL17.2
AT5G02610 Ribosomal L29 family protein ... Potri.008G048800 1.41 0.9799 RPL35.1
AT2G09990 Ribosomal protein S5 domain 2-... Potri.008G150000 2.82 0.9789
AT1G70600 Ribosomal protein L18e/L15 sup... Potri.008G187000 4.00 0.9749
AT3G04840 Ribosomal protein S3Ae (.1) Potri.008G156300 4.47 0.9783 RS3.2
AT3G02560 Ribosomal protein S7e family p... Potri.017G115400 4.58 0.9790
AT4G00100 PFL2, ATRPS13A POINTED FIRST LEAF 2, ribosoma... Potri.012G128600 4.69 0.9720 Pt-RPS13.2
AT5G24510 60S acidic ribosomal protein f... Potri.014G105400 5.09 0.9695
AT1G73230 Nascent polypeptide-associated... Potri.012G037900 5.56 0.9602
AT4G14320 Zinc-binding ribosomal protein... Potri.005G092500 5.91 0.9756

Potri.005G211200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.