Potri.005G214100 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G19670 59 / 3e-11 CORI1, ATHCOR1, ATCLH1 CORONATINE-INDUCED PROTEIN 1, chlorophyllase 1 (.1)
AT5G43860 48 / 1e-07 ATCLH2 ARABIDOPSIS THALIANA CHLOROPHYLLASE 2, chlorophyllase 2 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G214200 166 / 1e-51 AT1G19670 237 / 7e-76 CORONATINE-INDUCED PROTEIN 1, chlorophyllase 1 (.1)
Potri.010G082300 51 / 1e-08 AT5G43860 370 / 1e-128 ARABIDOPSIS THALIANA CHLOROPHYLLASE 2, chlorophyllase 2 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10004076 59 / 3e-11 AT1G19670 234 / 6e-75 CORONATINE-INDUCED PROTEIN 1, chlorophyllase 1 (.1)
Lus10014702 57 / 2e-10 AT1G19670 229 / 4e-73 CORONATINE-INDUCED PROTEIN 1, chlorophyllase 1 (.1)
Lus10039372 50 / 6e-08 AT5G43860 392 / 2e-137 ARABIDOPSIS THALIANA CHLOROPHYLLASE 2, chlorophyllase 2 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0028 AB_hydrolase PF07224 Chlorophyllase Chlorophyllase
Representative CDS sequence
>Potri.005G214100.1 pacid=42805425 polypeptide=Potri.005G214100.1.p locus=Potri.005G214100 ID=Potri.005G214100.1.v4.1 annot-version=v4.1
ATGGAAACACGCTTGGTATTTCTTTTGGCAGCGTTGTTGGCAACAGCACTGCTGGAATCTAAGCCTGTTTTGCCAACACTAGCGTCTGAAGCTGATCACT
CAGTTTCGGGTGTTTTCAAAACAGGAAAATTTCACCCAATACATTCTGATGTAGGAACAGCCTCTAGCTGTTCACCTCCTAGATCCTTGTTAATTGTTAG
ACCAGAAGAAAAGGGCACGTGTCCTGTCATCTTGTTTCACCACGGCACAGGCTGCCAGAACTCTTGGTACACTGATGTTTTCAAATTCATGTCTTCTCAT
GGATACATAGTGGTCGCACCGCAGGTTATTAAACCTTGA
AA sequence
>Potri.005G214100.1 pacid=42805425 polypeptide=Potri.005G214100.1.p locus=Potri.005G214100 ID=Potri.005G214100.1.v4.1 annot-version=v4.1
METRLVFLLAALLATALLESKPVLPTLASEADHSVSGVFKTGKFHPIHSDVGTASSCSPPRSLLIVRPEEKGTCPVILFHHGTGCQNSWYTDVFKFMSSH
GYIVVAPQVIKP

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G19670 CORI1, ATHCOR1,... CORONATINE-INDUCED PROTEIN 1, ... Potri.005G214100 0 1
AT4G26590 ATOPT5 ARABIDOPSIS THALIANA OLIGOPEPT... Potri.001G369700 3.60 0.9345
AT2G27240 Aluminium activated malate tra... Potri.001G217050 6.63 0.8971
AT5G45960 GDSL-like Lipase/Acylhydrolase... Potri.011G062000 7.87 0.9232
AT3G47800 Galactose mutarotase-like supe... Potri.017G080100 8.00 0.9032
AT1G03670 ankyrin repeat family protein ... Potri.013G134500 13.63 0.8834
AT5G18470 Curculin-like (mannose-binding... Potri.013G050500 13.85 0.9052
AT1G24140 Matrixin family protein (.1) Potri.013G033200 18.33 0.8884
AT3G11480 BSMT1, ATBSMT1 S-adenosyl-L-methionine-depend... Potri.019G022402 18.54 0.8880
AT3G54220 GRAS SGR1, SCR SHOOT GRAVITROPISM 1, SCARECRO... Potri.016G143833 18.65 0.9176
AT1G68480 C2H2ZnF JAG JAGGED, C2H2 and C2HC zinc fin... Potri.010G124200 21.49 0.8913 Pt-JAG.1

Potri.005G214100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.