Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G55190 131 / 1e-38 PRA7, PRA1.F2 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1) AT5G01640 115 / 4e-32 PRA1.B5 prenylated RAB acceptor 1.B5 (.1) AT1G17700 112 / 2e-31 PRA1.F1 prenylated RAB acceptor 1.F1 (.1) AT2G38360 113 / 4e-31 PRA1.B4 prenylated RAB acceptor 1.B4 (.1) AT3G13710 112 / 4e-31 PRA1.F4 prenylated RAB acceptor 1.F4 (.1) AT1G08770 112 / 6e-31 PRA1.E prenylated RAB acceptor 1.E (.1) AT2G40380 110 / 4e-30 PRA1.B2 prenylated RAB acceptor 1.B2 (.1) AT3G56110 107 / 4e-29 PRA1.B1 prenylated RAB acceptor 1.B1 (.1.2) AT3G13720 104 / 4e-28 PRA8, PRA1.F3 PRENYLATED RAB ACCEPTOR 1.F3, PRA1 (Prenylated rab acceptor) family protein (.1) AT1G04260 103 / 1e-27 PRA1.D, MPIP7, MPI7 PRENYLATED RAB ACCEPTOR 1.D, CAMV movement protein interacting protein 7 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G044000 [exp] 227 / 3e-76 AT1G55190 130 / 4e-38 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1) Potri.002G043800 [exp] 194 / 2e-63 AT1G55190 136 / 1e-40 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1) Potri.005G054700 [exp] 192 / 3e-62 AT1G08770 137 / 1e-40 prenylated RAB acceptor 1.E (.1) Potri.019G124100 [exp] 120 / 7e-34 AT5G05380 140 / 8e-42 prenylated RAB acceptor 1.B3 (.1) Potri.010G183300 [exp] 116 / 2e-32 AT3G56110 239 / 9e-81 prenylated RAB acceptor 1.B1 (.1.2) Potri.003G035200 [exp] 113 / 2e-31 AT1G55190 161 / 2e-50 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1) Potri.006G104400 [exp] 111 / 3e-30 AT2G38360 206 / 5e-67 prenylated RAB acceptor 1.B4 (.1) Potri.016G126400 [exp] 110 / 4e-30 AT2G38360 209 / 2e-68 prenylated RAB acceptor 1.B4 (.1) Potri.008G074033 [exp] 103 / 2e-27 AT3G56110 213 / 2e-70 prenylated RAB acceptor 1.B1 (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014747 [exp] 184 / 5e-59 AT1G55190 147 / 9e-45 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1) Lus10033859 [exp] 184 / 5e-59 AT1G55190 149 / 1e-45 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1) Lus10024861 [exp] 181 / 1e-57 AT1G08770 132 / 2e-38 prenylated RAB acceptor 1.E (.1) Lus10018774 [exp] 172 / 3e-54 AT1G08770 130 / 5e-38 prenylated RAB acceptor 1.E (.1) Lus10021996 [exp] 144 / 4e-43 AT1G08770 162 / 3e-50 prenylated RAB acceptor 1.E (.1) Lus10026404 [exp] 132 / 1e-38 AT2G38360 253 / 5e-86 prenylated RAB acceptor 1.B4 (.1) Lus10042246 [exp] 132 / 2e-38 AT2G38360 250 / 4e-84 prenylated RAB acceptor 1.B4 (.1) Lus10042535 [exp] 130 / 5e-38 AT1G08770 157 / 1e-48 prenylated RAB acceptor 1.E (.1) Lus10005088 [exp] 127 / 9e-37 AT1G55190 199 / 3e-65 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1) Lus10034363 [exp] 125 / 4e-36 AT1G55190 197 / 1e-64 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF03208 [poplar] [flax] PRA1 PRA1 family protein
Representative CDS sequence Show only first row Show all	>Potri.005G219100.1 pacid=42802425 polypeptide=Potri.005G219100.1.p locus=Potri.005G219100 ID=Potri.005G219100.1.v4.1 annot-version=v4.1 ATGATTTCTTCATATCCAGCTCCAGCTCCAGCTCCAGATCCGTACGATTCCCTCCCATCCGCCGCAGCTCCATCGACCTTCCTCACCCGCTCCGCCAATA CTACAACCAACTTCTTCGCCACGCGCCGTCCATGGCGCGAATTGATTGAATTCTCCTCCTTCACGCGCCCGCTCTCCTTCGGCGAAGCCACAATCCGCGT AAAACGCAACCTCTACTACTTTCGCGTTAATTACACTATGATAATCCTCGTTATACTCTTTTTAAGCCTCTTATGGCACCCTCTCTCGATGATTGTCTTC TTAGTCGTCTTTGTCGCTTGGTTTTTCCTCTACTTCTTTCGTGACCAGCCACTGGTGATTTTCCATCGTCCGATTGATGATCGTGTGGTGCTTGGTTTGC TTTCCATCGTGACTATTATTGCTTTGATTTTCACTCACGTCTGGTTAAATGTCTTGGTATCGGTTTTGATTGGGGCTGCTGTTGTTGTATTACACGCTGC GTTTAGGGGAACTGAGAATTTGTATTTGGATGAGCATGATTTGGCTGATGAAGGCTTGTTTTCTGTTGTGGGGAGTCCTATGAGAGATGGCTATACTCGC GTTTAA
AA sequence Show only first row Show all	>Potri.005G219100.1 pacid=42802425 polypeptide=Potri.005G219100.1.p locus=Potri.005G219100 ID=Potri.005G219100.1.v4.1 annot-version=v4.1 MISSYPAPAPAPDPYDSLPSAAAPSTFLTRSANTTTNFFATRRPWRELIEFSSFTRPLSFGEATIRVKRNLYYFRVNYTMIILVILFLSLLWHPLSMIVF LVVFVAWFFLYFFRDQPLVIFHRPIDDRVVLGLLSIVTIIALIFTHVWLNVLVSVLIGAAVVVLHAAFRGTENLYLDEHDLADEGLFSVVGSPMRDGYTR V

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G55190		PRA7, PRA1.F2	PRENYLATED RAB ACCEPTOR 1.F2, ...		Potri.005G219100 [exp]	0	1
AT5G65200		ATPUB38	ARABIDOPSIS THALIANA PLANT U-B...		Potri.012G076400 [exp]	11.74	0.7737
AT5G59910		HTB4	Histone superfamily protein (....		Potri.010G230701 [exp]	12.24	0.7137
AT3G50700	C2H2ZnF	ATIDD2	indeterminate(ID)-domain 2 (.1...		Potri.013G019200 [exp]	13.49	0.7389
AT1G10350			DNAJ heat shock family protein...		Potri.008G194000 [exp]	15.49	0.7456
AT3G14840			Leucine-rich repeat transmembr...		Potri.019G009700 [exp]	18.76	0.7532
					Potri.001G063309 [exp]	18.81	0.7688
AT5G57580			Calmodulin-binding protein (.1...		Potri.011G043200 [exp]	35.77	0.7516	CBP60.11
AT3G58060			Cation efflux family protein (...		Potri.001G010000 [exp]	43.04	0.7332
AT1G07870			Protein kinase superfamily pro...		Potri.001G234100 [exp]	50.64	0.7322
					Potri.018G096014 [exp]	54.89	0.7418

Compare expression of checked genes

Potri.005G219100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.