Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G42410 97 / 4e-25 C2H2ZnF ATZFP11, ZFP11 zinc finger protein 11 (.1) AT3G23130 79 / 3e-18 C2H2ZnF FLO10, FON1, SUP SUPERMAN, FLORAL ORGAN NUMBER 1, FLORAL DEFECTIVE 10, C2H2 and C2HC zinc fingers superfamily protein (.1) AT2G37740 76 / 3e-16 C2H2ZnF ATZFP10, ZFP10 zinc-finger protein 10 (.1) AT5G06070 72 / 2e-15 C2H2ZnF RAB, RBE RABBIT EARS, C2H2 and C2HC zinc fingers superfamily protein (.1) AT4G17810 68 / 4e-14 C2H2ZnF ZFP12 C2H2 and C2HC zinc fingers superfamily protein (.1) AT3G09290 65 / 4e-13 C2H2ZnF TAC1 telomerase activator1 (.1) AT3G53820 61 / 8e-12 C2H2ZnF C2H2 and C2HC zinc fingers superfamily protein (.1) AT5G43540 55 / 1e-09 C2H2ZnF C2H2 and C2HC zinc fingers superfamily protein (.1) AT1G67030 49 / 4e-07 C2H2ZnF ZFP6 zinc finger protein 6 (.1) AT3G23140 47 / 9e-07 C2H2ZnF URO UPRIGHT ROSETTE, C2H2 and C2HC zinc fingers superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G041700 [exp] 243 / 2e-82 AT2G42410 105 / 3e-28 zinc finger protein 11 (.1) Potri.008G163900 [exp] 84 / 5e-20 AT3G23130 119 / 1e-33 SUPERMAN, FLORAL ORGAN NUMBER 1, FLORAL DEFECTIVE 10, C2H2 and C2HC zinc fingers superfamily protein (.1) Potri.010G074500 [exp] 79 / 3e-18 AT3G23130 73 / 7e-16 SUPERMAN, FLORAL ORGAN NUMBER 1, FLORAL DEFECTIVE 10, C2H2 and C2HC zinc fingers superfamily protein (.1) Potri.006G089600 [exp] 76 / 1e-16 AT2G37740 102 / 2e-25 zinc-finger protein 10 (.1) Potri.016G101400 [exp] 76 / 2e-16 AT2G37740 108 / 3e-27 zinc-finger protein 10 (.1) Potri.008G059000 [exp] 74 / 6e-16 AT5G06070 99 / 2e-24 RABBIT EARS, C2H2 and C2HC zinc fingers superfamily protein (.1) Potri.010G199800 [exp] 74 / 7e-16 AT5G06070 100 / 4e-25 RABBIT EARS, C2H2 and C2HC zinc fingers superfamily protein (.1) Potri.001G142900 [exp] 73 / 1e-15 AT4G17810 135 / 1e-39 C2H2 and C2HC zinc fingers superfamily protein (.1) Potri.003G091200 [exp] 72 / 2e-15 AT4G17810 140 / 2e-41 C2H2 and C2HC zinc fingers superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022206 [exp] 77 / 3e-17 AT3G23130 100 / 1e-25 SUPERMAN, FLORAL ORGAN NUMBER 1, FLORAL DEFECTIVE 10, C2H2 and C2HC zinc fingers superfamily protein (.1) Lus10021215 [exp] 78 / 9e-17 AT3G23130 102 / 1e-25 SUPERMAN, FLORAL ORGAN NUMBER 1, FLORAL DEFECTIVE 10, C2H2 and C2HC zinc fingers superfamily protein (.1) Lus10021490 [exp] 74 / 8e-16 AT2G37740 103 / 1e-25 zinc-finger protein 10 (.1) Lus10024362 [exp] 74 / 8e-16 AT2G37740 105 / 4e-27 zinc-finger protein 10 (.1) Lus10010871 [exp] 74 / 9e-16 AT2G37740 103 / 9e-26 zinc-finger protein 10 (.1) Lus10004705 [exp] 70 / 8e-15 AT2G37740 100 / 1e-25 zinc-finger protein 10 (.1) Lus10030967 [exp] 70 / 2e-14 AT4G17810 112 / 1e-30 C2H2 and C2HC zinc fingers superfamily protein (.1) Lus10040083 [exp] 69 / 2e-14 AT4G17810 123 / 8e-35 C2H2 and C2HC zinc fingers superfamily protein (.1) Lus10022204 [exp] 62 / 2e-12 AT3G09290 67 / 2e-15 telomerase activator1 (.1) Lus10000481 [exp] 63 / 4e-12 AT4G17810 100 / 8e-26 C2H2 and C2HC zinc fingers superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.005G221400.1 pacid=42802632 polypeptide=Potri.005G221400.1.p locus=Potri.005G221400 ID=Potri.005G221400.1.v4.1 annot-version=v4.1 ATGGTCAAGAAATTTCCACAGGGAAGCAGCACGGTTAAAGACAAATGGGAGAAGAACAACGCGATCTTTCAAGGAGAGCATTCAAGCGTTTTTTCATGGC CTCAAAGAAACTACTCATGCAGCTTTTGCAAGAGACAATTCATCTCTGCTCAAGCACTTGGGGGCCATATGAACGTTCACAGGAGAGATAGAGCCAAGCT GAGACAGCTACCTTCTTGGTTTTTTAAATGTCCAAAGTACCCTACTACTAATCCGAACCCCGATCATTTACTTTCTTCGTCTTCTAAGTTCTTGCCGTAC CCTGATGATCACACTCATGATCATTCTCCATACCTGAGTTCTTTCTCTTCACCTTGTTGCCGAGAAAAGAAATCCATAGTTGAATGTCATGAAAGTAAAG ATTTAACAAAGAAGAAGAACAATGCAGGAGCTGTGTTCGGGGTTGGAGAATTGAAGAAAAATTTCGCACAAGAATGTGATCAACTTGAAGTTTTGAGGAG AAATGAGATTATTAACTTGGACATGGAAATGGGGTGCGAAGATCCGAAGGAGGTTTTGGATTTGGAGCTTCGACTTGGCCTTTTAGTATAA
AA sequence Show only first row Show all	>Potri.005G221400.1 pacid=42802632 polypeptide=Potri.005G221400.1.p locus=Potri.005G221400 ID=Potri.005G221400.1.v4.1 annot-version=v4.1 MVKKFPQGSSTVKDKWEKNNAIFQGEHSSVFSWPQRNYSCSFCKRQFISAQALGGHMNVHRRDRAKLRQLPSWFFKCPKYPTTNPNPDHLLSSSSKFLPY PDDHTHDHSPYLSSFSSPCCREKKSIVECHESKDLTKKKNNAGAVFGVGELKKNFAQECDQLEVLRRNEIINLDMEMGCEDPKEVLDLELRLGLLV

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G42410	C2H2ZnF	ATZFP11, ZFP11	zinc finger protein 11 (.1)		Potri.005G221400 [exp]	0	1
AT2G38060		PHT4;2	phosphate transporter 4;2 (.1)		Potri.016G111000 [exp]	3.87	0.8778
AT1G13330		AHP2	Arabidopsis Hop2 homolog (.1)		Potri.010G127101 [exp]	6.00	0.8164
					Potri.019G038310 [exp]	10.09	0.8214
AT1G11910		ATAPA1, APA1	aspartic proteinase A1 (.1)		Potri.004G007600 [exp]	14.00	0.8223
AT5G24090		ATCHIA	chitinase A (.1)		Potri.014G092932 [exp]	14.42	0.8069
AT5G50770		ATHSD6	hydroxysteroid dehydrogenase 6...		Potri.015G100102 [exp]	17.32	0.8113
AT3G60130		BGLU16	beta glucosidase 16 (.1.2.3)		Potri.001G226200 [exp]	18.33	0.8092	Pt-PLIN-GEN.19
AT3G22600			Bifunctional inhibitor/lipid-t...		Potri.002G050500 [exp]	20.61	0.8005
AT1G13340			Regulator of Vps4 activity in ...		Potri.010G127000 [exp]	23.36	0.8067
AT5G13420			Aldolase-type TIM barrel famil...		Potri.003G161900 [exp]	23.87	0.8172

Compare expression of checked genes

Potri.005G221400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.