Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G31200 225 / 5e-77 ADF6, ATADF6 actin depolymerizing factor 6 (.1) AT5G59890 178 / 1e-58 ADF4, ATADF4 actin depolymerizing factor 4 (.1.2) AT3G46010 177 / 5e-58 ATADF1, ADF1 actin depolymerizing factor 1 (.1.2) AT1G01750 169 / 3e-55 ADF11 actin depolymerizing factor 11 (.1) AT4G00680 169 / 4e-55 ADF8 actin depolymerizing factor 8 (.1) AT5G59880 167 / 3e-54 ADF3 actin depolymerizing factor 3 (.1.2) AT3G46000 167 / 4e-54 ADF2 actin depolymerizing factor 2 (.1) AT4G25590 164 / 4e-53 ADF7 actin depolymerizing factor 7 (.1) AT4G34970 162 / 3e-52 ADF9 actin depolymerizing factor 9 (.1) AT2G16700 162 / 4e-52 ADF5, ATADF5 actin depolymerizing factor 5 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G038800 [exp] 241 / 1e-83 AT2G31200 241 / 2e-83 actin depolymerizing factor 6 (.1) Potri.001G236700 [exp] 177 / 4e-58 AT5G59890 256 / 2e-89 actin depolymerizing factor 4 (.1.2) Potri.008G052100 [exp] 176 / 1e-57 AT5G59890 249 / 1e-86 actin depolymerizing factor 4 (.1.2) Potri.009G028200 [exp] 175 / 2e-57 AT5G59890 258 / 4e-90 actin depolymerizing factor 4 (.1.2) Potri.009G133100 [exp] 175 / 3e-57 AT2G16700 257 / 7e-90 actin depolymerizing factor 5 (.1.2) Potri.004G173800 [exp] 175 / 3e-57 AT2G16700 255 / 4e-89 actin depolymerizing factor 5 (.1.2) Potri.009G028100 [exp] 175 / 3e-57 AT5G59890 256 / 1e-89 actin depolymerizing factor 4 (.1.2) Potri.001G236400 [exp] 174 / 6e-57 AT5G59890 246 / 1e-85 actin depolymerizing factor 4 (.1.2) Potri.001G106200 [exp] 173 / 1e-56 AT4G00680 234 / 6e-81 actin depolymerizing factor 8 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022933 [exp] 224 / 1e-76 AT2G31200 254 / 9e-89 actin depolymerizing factor 6 (.1) Lus10024885 [exp] 206 / 9e-70 AT2G31200 230 / 3e-79 actin depolymerizing factor 6 (.1) Lus10024418 [exp] 176 / 8e-58 AT5G59890 249 / 6e-87 actin depolymerizing factor 4 (.1.2) Lus10024417 [exp] 174 / 1e-56 AT3G46010 250 / 3e-87 actin depolymerizing factor 1 (.1.2) Lus10025319 [exp] 174 / 1e-56 AT3G46010 250 / 3e-87 actin depolymerizing factor 1 (.1.2) Lus10025049 [exp] 169 / 4e-55 AT2G16700 232 / 9e-80 actin depolymerizing factor 5 (.1.2) Lus10027474 [exp] 161 / 6e-52 AT5G52360 244 / 6e-85 actin depolymerizing factor 10 (.1) Lus10023428 [exp] 164 / 3e-50 AT5G59890 244 / 4e-81 actin depolymerizing factor 4 (.1.2) Lus10040307 [exp] 162 / 3e-50 AT5G59890 243 / 2e-81 actin depolymerizing factor 4 (.1.2) Lus10039229 [exp] 153 / 1e-48 AT5G52360 231 / 6e-80 actin depolymerizing factor 10 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0092 [poplar] [flax] ADF PF00241 [poplar] [flax] Cofilin_ADF Cofilin/tropomyosin-type actin-binding protein
Representative CDS sequence Show only first row Show all	>Potri.005G223800.2 pacid=42804530 polypeptide=Potri.005G223800.2.p locus=Potri.005G223800 ID=Potri.005G223800.2.v4.1 annot-version=v4.1 ATGAATTTCAGAGGTGCAAGTCGGGCCAATGCATCATCCGGCATGGGGGTTGCTGATCACAGCAAAAATACATTTATTGAACTTCAGAGGAAGAAGGCAC ACCGATATGTGATCTTCAAAATTGAAGAGAAGAAGATGGAAGTTGTGGTCGAGAAGACCGGGGAGCCAGCTGAGAGCTATGAAGATTTCGCTGCATCTTT GCCTGACAATGATTGTCGATATGCTGTTTATGACTTCGATTTCGTGACTTCTGAGAATTGTCAAAAGAGCAAAATCTTCTTCATTGCATGGTCTCCTTCA ACCTCTCGAATCCGTGCTAAGGTGCTCTATGCCACATCTAAAGAGAGATTTAGAAGGGAACTGAATGGTATCCACTATGATATTCAGGCTACTGACCCTA CAGAGATGGATCTTGAAGTGATTAGAGACCGTGCAAATTAA
AA sequence Show only first row Show all	>Potri.005G223800.2 pacid=42804530 polypeptide=Potri.005G223800.2.p locus=Potri.005G223800 ID=Potri.005G223800.2.v4.1 annot-version=v4.1 MNFRGASRANASSGMGVADHSKNTFIELQRKKAHRYVIFKIEEKKMEVVVEKTGEPAESYEDFAASLPDNDCRYAVYDFDFVTSENCQKSKIFFIAWSPS TSRIRAKVLYATSKERFRRELNGIHYDIQATDPTEMDLEVIRDRAN

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G31200		ADF6, ATADF6	actin depolymerizing factor 6 ...		Potri.005G223800 [exp]	0	1
AT5G62530		ATP5CDH, ALDH12...	ARABIDOPSIS THALIANA DELTA1-PY...		Potri.015G064200 [exp]	2.00	0.7546	FIS1.3
AT3G60720		PDLP8	plasmodesmata-located protein ...		Potri.002G145400 [exp]	7.34	0.7859
AT1G73040			Mannose-binding lectin superfa...		Potri.012G140001 [exp]	18.41	0.7526
AT2G30540			Thioredoxin superfamily protei...		Potri.014G134300 [exp]	19.74	0.7387
AT2G23430		ICK1, KRP1	KIP-RELATED PROTEIN 1, Cyclin-...		Potri.007G042300 [exp]	26.11	0.7207
AT4G31240			protein kinase C-like zinc fin...		Potri.006G279400 [exp]	32.37	0.7370
AT1G10155		ATPP2-A10	phloem protein 2-A10 (.1)		Potri.015G120100 [exp]	35.91	0.7090
AT3G58720			RING/U-box superfamily protein...		Potri.014G139400 [exp]	37.54	0.7289
AT1G24577			unknown protein		Potri.006G159300 [exp]	38.88	0.6906
					Potri.010G239400 [exp]	41.07	0.7382

Compare expression of checked genes

Potri.005G223800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.