Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	Pt-RIC6.1
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G28556 106 / 4e-28 RIC7 PAK-box/P21-Rho-binding family protein (.1) AT3G23380 102 / 2e-26 RIC5 ROP-interactive CRIB motif-containing protein 5 (.1) AT2G33460 102 / 2e-26 RIC1 ROP-interactive CRIB motif-containing protein 1 (.1) AT2G20430 101 / 6e-26 RIC6 ROP-interactive CRIB motif-containing protein 6 (.1) AT1G04450 97 / 3e-24 RIC3 ROP-interactive CRIB motif-containing protein 3 (.1) AT4G04900 84 / 3e-20 RIC10 ROP-interactive CRIB motif-containing protein 10 (.1) AT1G03982 68 / 7e-14 PAK-box/P21-Rho-binding family protein (.1) AT1G61795 59 / 7e-11 PAK-box/P21-Rho-binding family protein (.1) AT4G21745 57 / 5e-10 PAK-box/P21-Rho-binding family protein (.1) AT1G27380 41 / 0.0001 RIC2 ROP-interactive CRIB motif-containing protein 2 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G035500 [exp] 283 / 2e-96 AT2G20430 105 / 1e-27 ROP-interactive CRIB motif-containing protein 6 (.1) Potri.010G069500 [exp] 112 / 2e-29 AT4G28556 99 / 1e-24 PAK-box/P21-Rho-binding family protein (.1) Potri.008G168900 [exp] 105 / 3e-27 AT2G33460 101 / 4e-26 ROP-interactive CRIB motif-containing protein 1 (.1) Potri.011G025300 [exp] 95 / 4e-24 AT4G04900 89 / 5e-23 ROP-interactive CRIB motif-containing protein 10 (.1) Potri.004G020650 [exp] 94 / 1e-23 AT4G04900 73 / 1e-16 ROP-interactive CRIB motif-containing protein 10 (.1) Potri.002G233400 [exp] 58 / 5e-10 AT5G16490 89 / 1e-22 ROP-interactive CRIB motif-containing protein 4 (.1) Potri.014G147000 [exp] 49 / 6e-07 AT5G16490 76 / 8e-18 ROP-interactive CRIB motif-containing protein 4 (.1) Potri.019G053300 [exp] 42 / 7e-05 AT5G16490 108 / 2e-30 ROP-interactive CRIB motif-containing protein 4 (.1) Potri.013G086600 [exp] 42 / 0.0001 AT5G16490 109 / 7e-31 ROP-interactive CRIB motif-containing protein 4 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10003625 [exp] 110 / 4e-30 AT4G28556 94 / 3e-24 PAK-box/P21-Rho-binding family protein (.1) Lus10008243 [exp] 106 / 2e-28 AT4G28556 94 / 3e-24 PAK-box/P21-Rho-binding family protein (.1) Lus10018362 [exp] 93 / 5e-23 AT4G04900 94 / 2e-24 ROP-interactive CRIB motif-containing protein 10 (.1) Lus10011805 [exp] 91 / 8e-22 AT2G33460 97 / 2e-24 ROP-interactive CRIB motif-containing protein 1 (.1) Lus10007648 [exp] 89 / 1e-21 AT4G04900 88 / 2e-22 ROP-interactive CRIB motif-containing protein 10 (.1) Lus10006763 [exp] 79 / 5e-18 AT4G04900 81 / 2e-19 ROP-interactive CRIB motif-containing protein 10 (.1) Lus10021168 [exp] 71 / 7e-14 AT2G33460 81 / 3e-17 ROP-interactive CRIB motif-containing protein 1 (.1) Lus10020060 [exp] 54 / 2e-08 AT3G54200 72 / 4e-15 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10021974 [exp] 42 / 9e-05 AT2G33460 51 / 4e-08 ROP-interactive CRIB motif-containing protein 1 (.1) Lus10041267 [exp] 41 / 0.0004 AT2G33460 55 / 5e-09 ROP-interactive CRIB motif-containing protein 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00786 [poplar] [flax] PBD P21-Rho-binding domain
Representative CDS sequence Show only first row Show all	>Potri.005G227500.1 pacid=42803685 polypeptide=Potri.005G227500.1.p locus=Potri.005G227500 ID=Potri.005G227500.1.v4.1 annot-version=v4.1 ATGTCAAACAACAAAATGAAGGGCCTATTAAAAGGCTTAAGATACATCTCTCAAATATTCGACAATGATGAGGAAGAGCCTGAAATGCAGATTGGTTTCC CCACAGATGTAAAACATGTTGCCCACATAGGATGGGATGGTCCCTCTGTAAATTCACCAAGCTGGATGAACGAGTTTCAATCTCAACCAGAATATTCATC AGCTCCCTCAAGTCTCAACAGAGACGCGAAGGAGGAAGGTTCTGCAAAATGGGTATCTGAAGCAGGTTCAAATCGAAAAGGTTCGCAGGCACCGAATTCT CCAGCAGGGGCGCCTAGTTCTCCAGCAGGGTCGCATAGTTCCCCAACTCAGGACTTGCCAGAATTGCCGAAATCATCTAGACGGCGTTCATCATCTGGTA CATCAGCTGAATCTCCAAGCAGAGAAAAATCAGATAAACCTAAACAATCTAGGCGGTCTTCACGAAATGGCACCAAAGAATTGGATGGTACTAGAACAAG TCGGAATCATAAGGATCCTAGTGGAGAAAGCGAGTCACCCTCAAATTTACATGACATACCGAAGAAATCTCGGAGGAAGAAGTCGAAAGATGCCTCTGTT GAGGGGTCAACTTCAAGATCGAGAGCTAAAGCCCCAGCTCAAGAGGGGGGTGGGGAGTCAGAAATGATTACCAAATCTAGTAACAGTAATGAGCAACGTC AAACCAGAGGTTCAAGTCCTTCACGAGATGTTGAGGAGAGTGGATTGAGTGGAATTTCTTGA
AA sequence Show only first row Show all	>Potri.005G227500.1 pacid=42803685 polypeptide=Potri.005G227500.1.p locus=Potri.005G227500 ID=Potri.005G227500.1.v4.1 annot-version=v4.1 MSNNKMKGLLKGLRYISQIFDNDEEEPEMQIGFPTDVKHVAHIGWDGPSVNSPSWMNEFQSQPEYSSAPSSLNRDAKEEGSAKWVSEAGSNRKGSQAPNS PAGAPSSPAGSHSSPTQDLPELPKSSRRRSSSGTSAESPSREKSDKPKQSRRSSRNGTKELDGTRTSRNHKDPSGESESPSNLHDIPKKSRRKKSKDASV EGSTSRSRAKAPAQEGGGESEMITKSSNSNEQRQTRGSSPSRDVEESGLSGIS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G28556		RIC7	PAK-box/P21-Rho-binding family...		Potri.005G227500 [exp]	0	1	Pt-RIC6.1
AT3G27440		UKL5	uridine kinase-like 5 (.1)		Potri.017G071200 [exp]	14.38	0.8034
AT3G61230	LIM	PLIM2c	PLIM2c, GATA type zinc finger ...		Potri.003G124300 [exp]	20.49	0.7740
AT1G64940		CYP89A6	"cytochrome P450, family 87, s...		Potri.013G076501 [exp]	27.34	0.7780
AT3G12620			Protein phosphatase 2C family ...		Potri.010G214700 [exp]	34.49	0.7528
AT1G75150			unknown protein		Potri.002G262800 [exp]	38.32	0.7266
AT2G13570	CCAAT	NF-YB7	"nuclear factor Y, subunit B7"...		Potri.005G065300 [exp]	55.49	0.7121
AT4G22820			A20/AN1-like zinc finger famil...		Potri.012G130100 [exp]	95.67	0.6870
AT3G13898			unknown protein		Potri.003G042300 [exp]	247.99	0.6655

Compare expression of checked genes

Potri.005G227500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.