Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G47271 251 / 1e-85 Cystathionine beta-synthase (CBS) family protein (.1) AT5G10860 220 / 2e-73 CBSX3 CBS domain containing protein 3, Cystathionine beta-synthase (CBS) family protein (.1) AT2G36500 59 / 4e-10 CBS / octicosapeptide/Phox/Bemp1 (PB1) domains-containing protein (.1) AT3G52950 56 / 3e-09 CBS / octicosapeptide/Phox/Bemp1 (PB1) domains-containing protein (.1), CBS / octicosapeptide/Phox/Bemp1 (PB1) domains-containing protein (.2) AT5G63490 54 / 1e-08 CBS / octicosapeptide/Phox/Bemp1 (PB1) domains-containing protein (.1) AT5G50530 52 / 4e-08 CBS / octicosapeptide/Phox/Bemp1 (PB1) domains-containing protein (.1) AT5G50640 52 / 4e-08 CBS / octicosapeptide/Phox/Bemp1 (PB1) domains-containing protein (.1) AT4G36910 41 / 0.0003 CBSX1, CDCP2, LEJ2 LOSS OF THE TIMING OF ET AND JA BIOSYNTHESIS 2, CYSTATHIONE [BETA]-SYNTHASE DOMAIN-CONTAINING PROTEIN 2, CBS domain containing protein 1, Cystathionine beta-synthase (CBS) family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G000100 [exp] 227 / 4e-76 AT5G10860 339 / 2e-120 CBS domain containing protein 3, Cystathionine beta-synthase (CBS) family protein (.1) Potri.013G161500 [exp] 223 / 3e-74 AT5G10860 343 / 8e-122 CBS domain containing protein 3, Cystathionine beta-synthase (CBS) family protein (.1) Potri.002G034800 [exp] 172 / 3e-55 AT1G47271 102 / 4e-28 Cystathionine beta-synthase (CBS) family protein (.1) Potri.005G070500 [exp] 59 / 5e-10 AT3G52950 750 / 0.0 CBS / octicosapeptide/Phox/Bemp1 (PB1) domains-containing protein (.1), CBS / octicosapeptide/Phox/Bemp1 (PB1) domains-containing protein (.2) Potri.012G099600 [exp] 53 / 3e-08 AT5G50530 639 / 0.0 CBS / octicosapeptide/Phox/Bemp1 (PB1) domains-containing protein (.1) Potri.007G098400 [exp] 51 / 2e-07 AT3G52950 728 / 0.0 CBS / octicosapeptide/Phox/Bemp1 (PB1) domains-containing protein (.1), CBS / octicosapeptide/Phox/Bemp1 (PB1) domains-containing protein (.2) Potri.015G098100 [exp] 50 / 4e-07 AT5G50530 628 / 0.0 CBS / octicosapeptide/Phox/Bemp1 (PB1) domains-containing protein (.1) Potri.012G097000 [exp] 40 / 0.0004 AT3G48530 572 / 0.0 SNF1-related protein kinase regulatory subunit gamma 1 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10001964 [exp] 248 / 7e-84 AT1G47271 202 / 5e-66 Cystathionine beta-synthase (CBS) family protein (.1) Lus10019117 [exp] 225 / 4e-75 AT5G10860 347 / 2e-123 CBS domain containing protein 3, Cystathionine beta-synthase (CBS) family protein (.1) Lus10034441 [exp] 225 / 9e-72 AT5G10860 350 / 4e-120 CBS domain containing protein 3, Cystathionine beta-synthase (CBS) family protein (.1) Lus10035014 [exp] 211 / 1e-69 AT5G10860 341 / 5e-121 CBS domain containing protein 3, Cystathionine beta-synthase (CBS) family protein (.1) Lus10021675 [exp] 208 / 1e-68 AT5G10860 338 / 7e-120 CBS domain containing protein 3, Cystathionine beta-synthase (CBS) family protein (.1) Lus10032625 [exp] 56 / 5e-09 AT5G50530 721 / 0.0 CBS / octicosapeptide/Phox/Bemp1 (PB1) domains-containing protein (.1) Lus10043123 [exp] 56 / 5e-09 AT5G50530 714 / 0.0 CBS / octicosapeptide/Phox/Bemp1 (PB1) domains-containing protein (.1) Lus10035965 [exp] 50 / 2e-07 AT3G52950 714 / 0.0 CBS / octicosapeptide/Phox/Bemp1 (PB1) domains-containing protein (.1), CBS / octicosapeptide/Phox/Bemp1 (PB1) domains-containing protein (.2) Lus10025698 [exp] 50 / 3e-07 AT3G52950 728 / 0.0 CBS / octicosapeptide/Phox/Bemp1 (PB1) domains-containing protein (.1), CBS / octicosapeptide/Phox/Bemp1 (PB1) domains-containing protein (.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00571 [poplar] [flax] CBS CBS domain
Representative CDS sequence Show only first row Show all	>Potri.005G228300.1 pacid=42803866 polypeptide=Potri.005G228300.1.p locus=Potri.005G228300 ID=Potri.005G228300.1.v4.1 annot-version=v4.1 ATGGAAGGACTTGTCCGAGGAATAAGATCTTGCCAGGAAACCCTCAGAGTTGCAATTCTAAAGCATCCCCGTGATAGAAGAGAAATATTTTCACGTTTTG GACGCGTTACATCCTCTCTTCCAGTGCGAGAGAAAGGACTAGAGAATCTAACAGTGGCAGATGTACTGATGACAAAGGGAGAAGACAAAATTGGCTCCTG GCTCTGGTGCCGCACCACCGATTCTGTCTATGATGCTGTGGAGAATATGGCAAAGAATAATATTGGATCATTGGTAGTCCTAAAGCCAGGAGAACAAGAA CTTATTGCAGGAATTATCACAGAGAGAGACTATATGAGGAAGATAATAGCACAAGGGAGATCATCTAAATACACAAGAGTCGGGGAAATTATGACTGATG AGGACAAATTAGTAACAGTGACATCTGACACCAGCATTCTACAAGCAATGCAGCTGATGACAGATCATCATATTCGGCATGTTCCGGTCATAGATGGAAA GATAGTTGGGATGGTTTCCATTGTAGATGTGGTTCGAGCTGTGGTAGAGCAGCAAGGTGGAGAATTGAAGCGGCTGAATGAGTTCATTAAAGGAGAATAC TATTAG
AA sequence Show only first row Show all	>Potri.005G228300.1 pacid=42803866 polypeptide=Potri.005G228300.1.p locus=Potri.005G228300 ID=Potri.005G228300.1.v4.1 annot-version=v4.1 MEGLVRGIRSCQETLRVAILKHPRDRREIFSRFGRVTSSLPVREKGLENLTVADVLMTKGEDKIGSWLWCRTTDSVYDAVENMAKNNIGSLVVLKPGEQE LIAGIITERDYMRKIIAQGRSSKYTRVGEIMTDEDKLVTVTSDTSILQAMQLMTDHHIRHVPVIDGKIVGMVSIVDVVRAVVEQQGGELKRLNEFIKGEY Y

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G47271			Cystathionine beta-synthase (C...		Potri.005G228300 [exp]	0	1
AT5G41470			Nuclear transport factor 2 (NT...		Potri.001G100500 [exp]	2.82	0.9828
AT5G20870			O-Glycosyl hydrolases family 1...		Potri.006G216700 [exp]	4.00	0.9720
AT3G20570		AtENODL9	early nodulin-like protein 9 (...		Potri.011G135400 [exp]	4.00	0.9825
AT1G54860			Glycoprotein membrane precurso...		Potri.005G034300 [exp]	5.74	0.9817
AT2G19480		NFA2, NFA02, NA...	NUCLEOSOME/CHROMATIN ASSEMBLY ...		Potri.003G021400 [exp]	7.48	0.9655	NFA903
AT5G18970			AWPM-19-like family protein (....		Potri.008G200300 [exp]	7.74	0.9773
AT2G20560			DNAJ heat shock family protein...		Potri.007G136600 [exp]	8.00	0.9475
AT5G24318			O-Glycosyl hydrolases family 1...		Potri.012G017800 [exp]	8.06	0.9772
AT4G05220			Late embryogenesis abundant (L...		Potri.011G027400 [exp]	9.16	0.9520
AT3G61172		LCR8	low-molecular-weight cysteine-...		Potri.016G061300 [exp]	9.38	0.9704

Compare expression of checked genes

Potri.005G228300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.