Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G75388 74 / 4e-20 CPuORF5 conserved peptide upstream open reading frame 5 (.1) AT4G34588 62 / 3e-15 CPuORF2 conserved peptide upstream open reading frame 2 (.1) AT2G18162 58 / 1e-13 CPuORF1 conserved peptide upstream open reading frame 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G032000 [exp] 80 / 3e-22 AT1G75388 76 / 5e-21 conserved peptide upstream open reading frame 5 (.1) Potri.007G020000 [exp] 67 / 2e-17 AT1G75388 69 / 2e-18 conserved peptide upstream open reading frame 5 (.1) Potri.009G119650 [exp] 65 / 2e-16 AT4G34588 72 / 2e-19 conserved peptide upstream open reading frame 2 (.1) Potri.004G158150 [exp] 64 / 4e-16 AT4G34588 71 / 5e-19 conserved peptide upstream open reading frame 2 (.1) Potri.005G119400 [exp] 64 / 5e-16 AT1G75388 61 / 3e-15 conserved peptide upstream open reading frame 5 (.1)
Flax homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.005G231250.1 pacid=42803239 polypeptide=Potri.005G231250.1.p locus=Potri.005G231250 ID=Potri.005G231250.1.v4.1 annot-version=v4.1 ATGTCTCCAGTTGTCAGTGAAATCATCCGGTCCGGGTTTATGATCAATTCCTCTTTCAGACGCAGGACCCATCTTGTTCAATCTTTCTCGGTTGTGTTCC TTTACTGGTTCTATGTTTTTTCAGAAATAATCTTTCAACTCTGCCTGGTTTGTAATATATAA
AA sequence Show only first row Show all	>Potri.005G231250.1 pacid=42803239 polypeptide=Potri.005G231250.1.p locus=Potri.005G231250 ID=Potri.005G231250.1.v4.1 annot-version=v4.1 MSPVVSEIIRSGFMINSSFRRRTHLVQSFSVVFLYWFYVFSEIIFQLCLVCNI

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G75388		CPuORF5	conserved peptide upstream ope...		Potri.005G231250 [exp]	0	1
AT1G75390	bZIP	ATBZIP44	basic leucine-zipper 44 (.1.2)		Potri.005G231300 [exp]	1.00	0.8820	Pt-GBF5.1
					Potri.002G214450 [exp]	5.47	0.6153
AT1G18330	MYB	RVE7, EPR1	REVEILLE 7, EARLY-PHYTOCHROME-...		Potri.012G038300 [exp]	8.66	0.6813	Pt-EPR1.2
AT3G10980		SAG20, WI12, AT...	PLAC8 family protein (.1)		Potri.010G182100 [exp]	12.12	0.5991
AT1G75388		CPuORF5	conserved peptide upstream ope...		Potri.002G032000 [exp]	12.48	0.6855
AT5G11730			Core-2/I-branching beta-1,6-N-...		Potri.006G233400 [exp]	17.29	0.6208
AT5G01650			Tautomerase/MIF superfamily pr...		Potri.016G126800 [exp]	22.78	0.6881
AT4G38620	MYB	AtMYB4	myb domain protein 4 (.1)		Potri.004G138000 [exp]	23.06	0.6480
AT5G20150		ATSPX1	ARABIDOPSIS THALIANA SPX DOMA...		Potri.006G069500 [exp]	31.03	0.6381
AT5G56000		Hsp81.4, AtHsp9...	HEAT SHOCK PROTEIN 90.4, HEAT ...		Potri.006G002800 [exp]	47.24	0.5415

Compare expression of checked genes

Potri.005G231250 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.