Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	Pt-GBF5.1
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G75390 172 / 2e-55 bZIP ATBZIP44 basic leucine-zipper 44 (.1.2) AT4G34590 145 / 3e-45 bZIP ATB2, ATBZIP11, BZIP11, GBF6 Arabidopsis thaliana basic leucine-zipper 11, G-box binding factor 6 (.1) AT2G18160 122 / 7e-36 bZIP GBF5, ATBZIP2 G-BOX BINDING FACTOR 5, basic leucine-zipper 2 (.1) AT3G62420 108 / 7e-31 bZIP ATBZIP53 basic region/leucine zipper motif 53 (.1) AT1G13600 74 / 5e-17 bZIP ATBZIP58 basic leucine-zipper 58 (.1) AT2G04038 74 / 5e-17 bZIP ATBZIP48 basic leucine-zipper 48 (.1) AT5G15830 74 / 7e-17 bZIP ATBZIP3 basic leucine-zipper 3 (.1) AT3G30530 73 / 1e-16 bZIP ATBZIP42 basic leucine-zipper 42 (.1) AT5G38800 66 / 4e-14 bZIP ATBZIP43 basic leucine-zipper 43 (.1) AT4G37730 66 / 4e-13 bZIP ATBZIP7 basic leucine-zipper 7 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G031900 [exp] 251 / 8e-87 AT1G75390 128 / 3e-38 basic leucine-zipper 44 (.1.2) Potri.009G119700 [exp] 192 / 1e-63 AT4G34590 154 / 9e-49 Arabidopsis thaliana basic leucine-zipper 11, G-box binding factor 6 (.1) Potri.004G158200 [exp] 186 / 2e-61 AT1G75390 152 / 8e-48 basic leucine-zipper 44 (.1.2) Potri.007G019900 [exp] 157 / 6e-50 AT1G75390 130 / 5e-39 basic leucine-zipper 44 (.1.2) Potri.005G119300 [exp] 154 / 1e-48 AT2G18160 130 / 3e-39 G-BOX BINDING FACTOR 5, basic leucine-zipper 2 (.1) Potri.002G196200 [exp] 120 / 1e-35 AT3G62420 182 / 3e-60 basic region/leucine zipper motif 53 (.1) Potri.014G120800 [exp] 107 / 2e-30 AT3G62420 161 / 8e-52 basic region/leucine zipper motif 53 (.1) Potri.007G006900 [exp] 86 / 5e-21 AT2G22850 118 / 1e-32 basic leucine-zipper 6 (.1.2) Potri.008G106700 [exp] 81 / 5e-20 AT3G62420 88 / 6e-23 basic region/leucine zipper motif 53 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10001347 [exp] 193 / 5e-64 AT1G75390 159 / 4e-50 basic leucine-zipper 44 (.1.2) Lus10024279 [exp] 192 / 2e-63 AT1G75390 166 / 6e-53 basic leucine-zipper 44 (.1.2) Lus10028333 [exp] 136 / 5e-41 AT1G75390 134 / 5e-40 basic leucine-zipper 44 (.1.2) Lus10041780 [exp] 135 / 6e-41 AT1G75390 135 / 2e-40 basic leucine-zipper 44 (.1.2) Lus10040428 [exp] 128 / 6e-38 AT1G75390 148 / 8e-46 basic leucine-zipper 44 (.1.2) Lus10010005 [exp] 117 / 3e-34 AT3G62420 164 / 1e-52 basic region/leucine zipper motif 53 (.1) Lus10025024 [exp] 116 / 1e-33 AT3G62420 161 / 9e-52 basic region/leucine zipper motif 53 (.1) Lus10029101 [exp] 76 / 3e-17 AT3G30530 148 / 5e-45 basic leucine-zipper 42 (.1) Lus10016884 [exp] 73 / 5e-17 AT5G49450 80 / 8e-20 basic leucine-zipper 1 (.1) Lus10013059 [exp] 75 / 6e-17 AT3G30530 147 / 8e-45 basic leucine-zipper 42 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0018 [poplar] [flax] bZIP PF00170 [poplar] [flax] bZIP_1 bZIP transcription factor
Representative CDS sequence Show only first row Show all	>Potri.005G231300.1 pacid=42804848 polypeptide=Potri.005G231300.1.p locus=Potri.005G231300 ID=Potri.005G231300.1.v4.1 annot-version=v4.1 ATGGCATCCTCCAGTGGGGATTCCTCAGGTTTCACTCAGCTCCAAAACTCAGGCTCTGAAGAGAATACGCAGATGATGTTGGTGGATCAAAGGAAAAGGA AGAGAATGCAATCAAACAGAGAATCTGCAAGGAGATCCAGGATGAAAAAACAGAAGCACTTGGATGATTTAATGGCCCAAGTGACACAGCTAAGGAAGGA CAATAACCAAATCCTTACAACCATCAATGTCACAACACAGCACTACTTGAATGTTGAAGCCGAGAATTCTATTCTAAGGGCACAAATGATGGAACTGAAC CATAGACTTGATTCTCTTAACGAGATCCTCAACTATATCAACACGAGTAATGGGATTTTTGAAAATGATCATCACGAGGATCTCCCTGATCATAGCTTCA TGAATCCATCAAATCTGTTCTATCTTAACCAGCCCATCATGGCATCCCCAGATTTGTTTCAGTATTGA
AA sequence Show only first row Show all	>Potri.005G231300.1 pacid=42804848 polypeptide=Potri.005G231300.1.p locus=Potri.005G231300 ID=Potri.005G231300.1.v4.1 annot-version=v4.1 MASSSGDSSGFTQLQNSGSEENTQMMLVDQRKRKRMQSNRESARRSRMKKQKHLDDLMAQVTQLRKDNNQILTTINVTTQHYLNVEAENSILRAQMMELN HRLDSLNEILNYINTSNGIFENDHHEDLPDHSFMNPSNLFYLNQPIMASPDLFQY

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G75390	bZIP	ATBZIP44	basic leucine-zipper 44 (.1.2)		Potri.005G231300 [exp]	0	1	Pt-GBF5.1
AT1G75388		CPuORF5	conserved peptide upstream ope...		Potri.005G231250 [exp]	1.00	0.8820
AT4G35510			unknown protein		Potri.005G102000 [exp]	9.53	0.7620
AT1G20440		AtCOR47, RD17, ...	cold-regulated 47 (.1)		Potri.002G013200 [exp]	16.67	0.7867
AT1G10790			unknown protein		Potri.001G210600 [exp]	23.23	0.7654
					Potri.016G041301 [exp]	23.74	0.7812
AT2G39760		ATBPM3	BTB/POZ/MATH-domains containin...		Potri.010G199200 [exp]	24.12	0.7763
AT1G75390	bZIP	ATBZIP44	basic leucine-zipper 44 (.1.2)		Potri.002G031900 [exp]	24.37	0.7553	GBF5.2
AT1G24330			ARM repeat superfamily protein...		Potri.008G177100 [exp]	26.26	0.7585
AT2G27180			unknown protein		Potri.009G151600 [exp]	28.37	0.7771
AT5G23090	CCAAT	NF-YB13	"nuclear factor Y, subunit B13...		Potri.012G058200 [exp]	32.52	0.7479	Pt-DR1.2

Compare expression of checked genes

Potri.005G231300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.