Potri.005G231400 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G04940 360 / 2e-126 AtTic20-I, atTIC20, TIC20 translocon at the inner envelope membrane of chloroplasts 20-I, translocon at the inner envelope membrane of chloroplasts 20 (.1)
AT1G04945 320 / 7e-106 HIT-type Zinc finger family protein (.1.2.3)
AT4G03320 172 / 3e-52 AtTic20-IV, TIC20-IV translocon at the inner envelope membrane of chloroplasts 20-IV (.1)
AT2G47840 45 / 2e-05 AtTic20-II translocon at the inner envelope membrane of chloroplasts 20-II, Uncharacterised conserved protein ycf60 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G031800 449 / 9e-162 AT1G04940 363 / 1e-127 translocon at the inner envelope membrane of chloroplasts 20-I, translocon at the inner envelope membrane of chloroplasts 20 (.1)
Potri.019G108800 185 / 4e-57 AT4G03320 283 / 2e-95 translocon at the inner envelope membrane of chloroplasts 20-IV (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10033195 350 / 2e-122 AT1G04940 341 / 7e-119 translocon at the inner envelope membrane of chloroplasts 20-I, translocon at the inner envelope membrane of chloroplasts 20 (.1)
Lus10010636 348 / 1e-121 AT1G04940 338 / 9e-118 translocon at the inner envelope membrane of chloroplasts 20-I, translocon at the inner envelope membrane of chloroplasts 20 (.1)
Lus10039783 167 / 2e-50 AT4G03320 263 / 1e-87 translocon at the inner envelope membrane of chloroplasts 20-IV (.1)
Lus10026842 41 / 0.0004 AT2G47840 219 / 1e-72 translocon at the inner envelope membrane of chloroplasts 20-II, Uncharacterised conserved protein ycf60 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF16166 TIC20 Chloroplast import apparatus Tic20-like
Representative CDS sequence
>Potri.005G231400.1 pacid=42804096 polypeptide=Potri.005G231400.1.p locus=Potri.005G231400 ID=Potri.005G231400.1.v4.1 annot-version=v4.1
ATGCTTCTGAATGACTGCACCATGCCCTCTGGGTCTGGTTTTACTAACACCAGAGCATGTAAAACTATGCCTGGTATTGTGGTTTCGGCAAGTGTTCCTT
GCACAACTGCCAGGGCTGCATTGTTGAACAGCAGGGCTTCATTGGGACGACAATTGGACTCTAAATCCTGGTCATCTAGAGGTTTGCCTTCTTTGCTTCT
TTCAGCTGCATCAATGCCTCTCTTAAGTGGAGATTATGGTAGATTTTCACACAATATTCCCACATATCCTCGGCAGCGCAGATCCTATTCATGCCCTCGA
GCATCAAAAGATGTCCCATACAGTTATCGATTTCCTCCAATGACCAAGAAGCCAGGATGGTGGTGGAGGACTTTAGCATGCCTGCCCTATTTGATGCCTC
TTCATGAAACATGGATGTATGCTGAGACGGCATATCATCTACATCCGTTCCTTGAAGACTTTGAATTTTTGACCTACCCATTCCTTGGAGCCATTGGGAG
GTTACCAAGCTGGTTCTTGATGGCATATTTCTTTGTTGCATATCTTGGAGTGGTGAGGAGGAAGGAGTGGCCTCACTTTTTCAGATTTCATGTGGTAATG
GGCATGCTATTGGAGATTGCTCTCCAGGTTATAGGTACAGTGAGCCGATGGATGCCACTTGCTGTTTATTGGGGTAAACTGGGCATGCACTTCTGGACAG
CCGTGGCATTTGCTTATCTTTTTACAGTCCTAGAGTGCATACGTTGTGCTCTTGCTGGTATGTATGCTGATGTCCCTTTTGCCTGTGATGCGGCATACAT
TCAAATCCCATATGATTAA
AA sequence
>Potri.005G231400.1 pacid=42804096 polypeptide=Potri.005G231400.1.p locus=Potri.005G231400 ID=Potri.005G231400.1.v4.1 annot-version=v4.1
MLLNDCTMPSGSGFTNTRACKTMPGIVVSASVPCTTARAALLNSRASLGRQLDSKSWSSRGLPSLLLSAASMPLLSGDYGRFSHNIPTYPRQRRSYSCPR
ASKDVPYSYRFPPMTKKPGWWWRTLACLPYLMPLHETWMYAETAYHLHPFLEDFEFLTYPFLGAIGRLPSWFLMAYFFVAYLGVVRRKEWPHFFRFHVVM
GMLLEIALQVIGTVSRWMPLAVYWGKLGMHFWTAVAFAYLFTVLECIRCALAGMYADVPFACDAAYIQIPYD

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G04940 AtTic20-I, atTI... translocon at the inner envelo... Potri.005G231400 0 1
AT5G08400 Protein of unknown function (D... Potri.010G255300 2.23 0.9490
AT1G07700 Thioredoxin superfamily protei... Potri.014G029200 3.46 0.9549
AT1G02560 NCLPP5, NCLPP1,... NUCLEAR CLPP 5, NUCLEAR-ENCODE... Potri.002G195200 6.00 0.9438 CLPP5.2
AT1G16080 unknown protein Potri.003G185501 9.38 0.9519
AT3G02720 Class I glutamine amidotransfe... Potri.017G143880 11.91 0.8919
AT5G27390 Mog1/PsbP/DUF1795-like photosy... Potri.013G026500 12.64 0.9479
AT2G04790 unknown protein Potri.014G162700 13.03 0.9397
AT3G54210 Ribosomal protein L17 family p... Potri.016G143100 13.74 0.9504
AT1G35680 RPL21C chloroplast ribosomal protein ... Potri.019G083400 13.85 0.9495 Pt-RPL21.3
AT4G08280 Thioredoxin superfamily protei... Potri.002G085200 13.85 0.9143

Potri.005G231400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.