Plant FIBer expression Database

Potri.005G233000 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G06060 201 / 2e-65 LisH and RanBPM domains containing protein (.1)
AT1G61150 66 / 7e-13 LisH and RanBPM domains containing protein (.1.2.3.4.5.6.7)
AT1G35470 53 / 5e-08 SPla/RYanodine receptor (SPRY) domain-containing protein (.1), SPla/RYanodine receptor (SPRY) domain-containing protein (.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G029700
[exp]
287 / 3e-99 AT1G06060 283 / 1e-97 LisH and RanBPM domains containing protein (.1)
Potri.011G046200
[exp]
67 / 2e-13 AT1G61150 383 / 3e-136 LisH and RanBPM domains containing protein (.1.2.3.4.5.6.7)
Potri.004G037600
[exp]
64 / 4e-12 AT1G61150 384 / 3e-137 LisH and RanBPM domains containing protein (.1.2.3.4.5.6.7)
Potri.013G108400
[exp]
51 / 2e-07 AT1G35470 607 / 0.0 SPla/RYanodine receptor (SPRY) domain-containing protein (.1), SPla/RYanodine receptor (SPRY) domain-containing protein (.2)
Potri.019G080800
[exp]
42 / 0.0002 AT1G35470 610 / 0.0 SPla/RYanodine receptor (SPRY) domain-containing protein (.1), SPla/RYanodine receptor (SPRY) domain-containing protein (.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10004152
[exp]
227 / 1e-75 AT1G06060 275 / 2e-94 LisH and RanBPM domains containing protein (.1)
Lus10005633
[exp]
226 / 2e-75 AT1G06060 275 / 2e-94 LisH and RanBPM domains containing protein (.1)
Lus10011219
[exp]
66 / 8e-13 AT1G61150 392 / 6e-140 LisH and RanBPM domains containing protein (.1.2.3.4.5.6.7)
Lus10018464
[exp]
66 / 1e-12 AT1G61150 392 / 9e-140 LisH and RanBPM domains containing protein (.1.2.3.4.5.6.7)
Lus10009451
[exp]
49 / 1e-06 AT1G35470 601 / 0.0 SPla/RYanodine receptor (SPRY) domain-containing protein (.1), SPla/RYanodine receptor (SPRY) domain-containing protein (.2)
Lus10001544
[exp]
47 / 4e-06 AT1G35470 604 / 0.0 SPla/RYanodine receptor (SPRY) domain-containing protein (.1), SPla/RYanodine receptor (SPRY) domain-containing protein (.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF10607 CLTH CTLH/CRA C-terminal to LisH motif domain
Representative CDS sequence
>Potri.005G233000.7 pacid=42805411 polypeptide=Potri.005G233000.7.p locus=Potri.005G233000 ID=Potri.005G233000.7.v4.1 annot-version=v4.1
ATGGACGTTGATCCTCGTCACTACGAACAGATTGGTATCAAAGATAATGATATCCACAATATTGTGCTATCCTATCTGGTGCATAATTGTTATAGAGAAA
CTCTGGAATCATTCGTGGATTGTACTGGGATGCCAGAACCTGCAGATTATATTGAGGATATGGAGAAAAGAAAAGGGATATTCTGTTGTGTCCTAGAGGG
GAATGCACTAAAGGCCATTGAACTGACAGAACAAGTGGCCTGTGACTTATTGGAGAATAACAAGGACTTGCATTTTGATCTTTTGAGCCTTCATTTTGTT
GAGCTTGTTTGTGCTAAGAAGTGCACTGAAGCTTTGGAATTTGCCCAAAACAAGTTGATGCCATTTGGGAAGGAGCAGAAGTTACTTGAAAAGCTTGAAG
ACTTTCTGTCTCTGCTTGCTTATGAGGAACCAGAAAAATCACCAATGTTTCATCTGCTTGGCTCGGAGTACCGGCAGCATGTTGCAGACAAACTAAACCG
AGCCATTCTTGGTTTGTTCCTGCAGTTTTTTTCCTTGTTCCATGTTTTTTCAGAAGATTCCATACTAACAAATGTGCTTCTTGTTGATTTGATGATTCTT
TCTATAATTATCGTTCACACTCTTCTCTATTTATTTGTTGGTCCTGAATGA
AA sequence
>Potri.005G233000.7 pacid=42805411 polypeptide=Potri.005G233000.7.p locus=Potri.005G233000 ID=Potri.005G233000.7.v4.1 annot-version=v4.1
MDVDPRHYEQIGIKDNDIHNIVLSYLVHNCYRETLESFVDCTGMPEPADYIEDMEKRKGIFCCVLEGNALKAIELTEQVACDLLENNKDLHFDLLSLHFV
ELVCAKKCTEALEFAQNKLMPFGKEQKLLEKLEDFLSLLAYEEPEKSPMFHLLGSEYRQHVADKLNRAILGLFLQFFSLFHVFSEDSILTNVLLVDLMIL
SIIIVHTLLYLFVGPE

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G06060 LisH and RanBPM domains contai... Potri.005G233000
[exp]
0 1
AT3G03300 ATDCL2, DCL2 dicer-like 2 (.1.2.3) Potri.010G181400
[exp]
4.00 0.8148
AT1G16220 Protein phosphatase 2C family ... Potri.001G473300
[exp]
6.00 0.8483
AT4G23895 Pleckstrin homology (PH) domai... Potri.001G091100
[exp]
13.41 0.7867
AT4G25650 TIC55-IV, PTC52... TRANSLOCON AT THE INNER ENVELO... Potri.003G218900
[exp]
15.87 0.8014
Potri.004G011300
[exp]
17.88 0.8056
AT5G61910 DCD (Development and Cell Deat... Potri.012G108200
[exp]
20.68 0.7316 Pt-BON1.3
AT4G27220 NB-ARC domain-containing disea... Potri.019G014374
[exp]
23.21 0.8013
AT1G12000 Phosphofructokinase family pro... Potri.004G003800
[exp]
29.56 0.7651
AT1G32410 Vacuolar protein sorting 55 (V... Potri.001G146600
[exp]
31.46 0.7652
AT3G17310 DRM3, AtDRM3 domains rearranged methyltrans... Potri.010G152200
[exp]
31.49 0.7881

Potri.005G233000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.