Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	Pt-VFCYSPRO.2
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G39090 501 / 6e-179 EMB3005, RD19A, RD19 RESPONSIVE TO DEHYDRATION 19A, RESPONSIVE TO DEHYDRATION 19, Papain family cysteine protease (.1) AT4G16190 497 / 3e-177 Papain family cysteine protease (.1) AT2G21430 496 / 3e-177 Papain family cysteine protease (.1) AT3G54940 398 / 3e-138 Papain family cysteine protease (.2) AT3G19400 216 / 4e-67 Cysteine proteinases superfamily protein (.1.2) AT3G19390 197 / 6e-59 Granulin repeat cysteine protease family protein (.1) AT5G60360 194 / 1e-58 SAG2, AALP SENESCENCE ASSOCIATED GENE2, aleurain-like protease (.1.2.3) AT3G45310 189 / 7e-57 Cysteine proteinases superfamily protein (.1.2) AT1G09850 189 / 5e-56 XBCP3 xylem bark cysteine peptidase 3 (.1) AT3G43960 186 / 1e-55 Cysteine proteinases superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G028700 [exp] 598 / 0 AT4G39090 536 / 0.0 RESPONSIVE TO DEHYDRATION 19A, RESPONSIVE TO DEHYDRATION 19, Papain family cysteine protease (.1) Potri.004G160300 [exp] 525 / 0 AT4G39090 549 / 0.0 RESPONSIVE TO DEHYDRATION 19A, RESPONSIVE TO DEHYDRATION 19, Papain family cysteine protease (.1) Potri.009G121300 [exp] 514 / 0 AT4G39090 571 / 0.0 RESPONSIVE TO DEHYDRATION 19A, RESPONSIVE TO DEHYDRATION 19, Papain family cysteine protease (.1) Potri.010G228400 [exp] 367 / 5e-126 AT3G54940 501 / 6e-179 Papain family cysteine protease (.2) Potri.007G047600 [exp] 194 / 1e-58 AT5G43060 461 / 9e-162 Granulin repeat cysteine protease family protein (.1) Potri.006G141700 [exp] 187 / 3e-56 AT3G45310 590 / 0.0 Cysteine proteinases superfamily protein (.1.2) Potri.005G141600 [exp] 187 / 7e-56 AT4G36880 437 / 1e-153 cysteine proteinase1 (.1) Potri.004G207600 [exp] 186 / 1e-55 AT4G35350 543 / 0.0 xylem cysteine peptidase 1 (.1.2) Potri.014G024100 [exp] 186 / 2e-54 AT5G43060 646 / 0.0 Granulin repeat cysteine protease family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024303 [exp] 526 / 0 AT4G39090 520 / 0.0 RESPONSIVE TO DEHYDRATION 19A, RESPONSIVE TO DEHYDRATION 19, Papain family cysteine protease (.1) Lus10028797 [exp] 486 / 6e-173 AT4G39090 559 / 0.0 RESPONSIVE TO DEHYDRATION 19A, RESPONSIVE TO DEHYDRATION 19, Papain family cysteine protease (.1) Lus10017487 [exp] 479 / 1e-170 AT4G39090 550 / 0.0 RESPONSIVE TO DEHYDRATION 19A, RESPONSIVE TO DEHYDRATION 19, Papain family cysteine protease (.1) Lus10002103 [exp] 423 / 1e-149 AT4G39090 431 / 5e-153 RESPONSIVE TO DEHYDRATION 19A, RESPONSIVE TO DEHYDRATION 19, Papain family cysteine protease (.1) Lus10038684 [exp] 372 / 2e-127 AT3G54940 499 / 1e-177 Papain family cysteine protease (.2) Lus10037951 [exp] 344 / 5e-115 AT3G54940 451 / 6e-157 Papain family cysteine protease (.2) Lus10017489 [exp] 265 / 2e-88 AT4G39090 314 / 5e-108 RESPONSIVE TO DEHYDRATION 19A, RESPONSIVE TO DEHYDRATION 19, Papain family cysteine protease (.1) Lus10003275 [exp] 186 / 9e-56 AT5G45890 392 / 1e-136 senescence-associated gene 12 (.1) Lus10033428 [exp] 186 / 2e-55 AT3G45310 565 / 0.0 Cysteine proteinases superfamily protein (.1.2) Lus10015285 [exp] 184 / 2e-55 AT5G45890 406 / 8e-143 senescence-associated gene 12 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0125 [poplar] [flax] Peptidase_CA PF00112 [poplar] [flax] Peptidase_C1 Papain family cysteine protease CL0125 [poplar] [flax] PF08246 [poplar] [flax] Inhibitor_I29 Cathepsin propeptide inhibitor domain (I29)
Representative CDS sequence Show only first row Show all	>Potri.005G234000.1 pacid=42803386 polypeptide=Potri.005G234000.1.p locus=Potri.005G234000 ID=Potri.005G234000.1.v4.1 annot-version=v4.1 ATGGAACGCTTACCTCTGCTCTTTCTCCTCCTCCTTACAGCCCTATCCTCCACCCTAGCATCCACAGTATCTTCCAGCGATCTCGACGATCCTTTAATCA GGCAAGTCGTGTCAGAGGGCGAGGATCATCTCCTCAACGCAGAGCATCATTTCACCACTTTCAAGTCCAAATTCGGCAAAAATTATGCGACTCAAGAGGA ACATGATTACCGATTTAGTGTTTTCAAAGCTAATCTCCTCCGTGCCAAGAAACACCAGATAATGGACCCTACCGCTGCCCATGGCGTCACTAAATTCTCT GATCTTACTCCCAAAGAATTCCGCCGCCAGCTCCTTGGATTGAAGCGGCGGCTTCGGTTGCCGACGGATGCTAACAAGGCGCCGATCCTTCCTACTGGCG ATCTTCCTACTGATTTTGACTGGCGTGACCACGGTGCCGTTACTAGCGTCAAAGACCAGGGATCGTGTGGATCGTGCTGGTCGTTTAGTGCTACAGGGGC ATTGGAAGGAGCTCATTACTTAGCAACAGGAGAGCTTGTAAGCTTGAGCGAGCAACAGCTTGTGGATTGTGATCACGAGTGTGATCCAGAAGAATATGGT GCCTGTGACTCGGGCTGCAGTGGTGGGCTGATGAACAATGCCTTTGAGTACGCACTGAAGGCCGGTGGTCTTGAACGTGAGAAGGACTATCCTTATACCG GAAATGATCGTGGTGCTTGCAAATTTGAGAAGAGCAAAGTCGCTGCATCGGTATCTAACTTCAGTGTTGTTTCCCTAGATGAAGATCAAATTGCTGCCAA TCTGGTGAAGCATGGTCCACTCTCAGTGGCTATCAATGCAGTTTTTATGCAGACATACATAGGTGGAGTTTCATGCCCATACATTTGCTCAAAGCACCAG GATCATGGGGTGCTGCTGGTGGGTTATGGAGCTGCTGGTTATGCTCCTATCCGGTTCAAGGAAAAGCCTTTCTGGATTATCAAGAACTCATGGGGAGAGA ATTGGGGAGAGAATGGGTATTACAAGATCTGCAGGGCTCGCAACATATGTGGTGTGGATTCCATGGTTTCAACTGTCGCTGCTATTCACGCTACTGCCCA GTAG
AA sequence Show only first row Show all	>Potri.005G234000.1 pacid=42803386 polypeptide=Potri.005G234000.1.p locus=Potri.005G234000 ID=Potri.005G234000.1.v4.1 annot-version=v4.1 MERLPLLFLLLLTALSSTLASTVSSSDLDDPLIRQVVSEGEDHLLNAEHHFTTFKSKFGKNYATQEEHDYRFSVFKANLLRAKKHQIMDPTAAHGVTKFS DLTPKEFRRQLLGLKRRLRLPTDANKAPILPTGDLPTDFDWRDHGAVTSVKDQGSCGSCWSFSATGALEGAHYLATGELVSLSEQQLVDCDHECDPEEYG ACDSGCSGGLMNNAFEYALKAGGLEREKDYPYTGNDRGACKFEKSKVAASVSNFSVVSLDEDQIAANLVKHGPLSVAINAVFMQTYIGGVSCPYICSKHQ DHGVLLVGYGAAGYAPIRFKEKPFWIIKNSWGENWGENGYYKICRARNICGVDSMVSTVAAIHATAQ

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G39090		EMB3005, RD19A,...	RESPONSIVE TO DEHYDRATION 19A,...		Potri.005G234000 [exp]	0	1	Pt-VFCYSPRO.2
AT3G57090		FIS1A, BIGYIN	FISSION 1A, Tetratricopeptide ...		Potri.016G038900 [exp]	4.24	0.9070
AT5G53160		RCAR3, PYL8	PYR1-like 8, regulatory compon...		Potri.015G020500 [exp]	7.21	0.8907
					Potri.005G239800 [exp]	7.74	0.8750
AT1G34060			Pyridoxal phosphate (PLP)-depe...		Potri.002G064000 [exp]	9.48	0.8595	ATMEPCT.1
AT4G08850			Leucine-rich repeat receptor-l...		Potri.013G036600 [exp]	10.95	0.8709
AT1G75210			HAD-superfamily hydrolase, sub...		Potri.014G196700 [exp]	14.45	0.8587
AT3G51000			alpha/beta-Hydrolases superfam...		Potri.007G018900 [exp]	14.96	0.8712
AT3G20500		ATPAP18, PAP18	purple acid phosphatase 18 (.1...		Potri.011G138200 [exp]	17.29	0.8521
AT3G14690		CYP72A15	"cytochrome P450, family 72, s...		Potri.011G099400 [exp]	19.59	0.8410
AT3G14690		CYP72A15	"cytochrome P450, family 72, s...		Potri.011G101500 [exp]	20.12	0.8354

Compare expression of checked genes

Potri.005G234000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.