Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G19910 225 / 2e-76 AVA-2PE, ATVHA-C2, AVA-P2 VACUOLAR-TYPE H+ ATPASE C2, ATPase, F0/V0 complex, subunit C protein (.1) AT4G34720 223 / 2e-75 ATVHA-C1, AVA-P1 VACUOLAR H+-PUMPING ATPASE C1, ATPase, F0/V0 complex, subunit C protein (.1) AT4G38920 223 / 2e-75 AVA-P3, ATVHA-C3 vacuolar-type H\(+\)-ATPase C3, vacuolar-type H\(+\)-ATPase C3, vacuolar-type H(+)-ATPase C3 (.1) AT2G16510 223 / 2e-75 AVA-P1 ATPase, F0/V0 complex, subunit C protein (.1) AT1G75630 221 / 9e-75 AVA-P4, AVA-P vacuolar H+-pumping ATPase 16 kDa proteolipid subunit 4, vacuolar H+-pumping ATPase 16 kDa proteolipid subunit 4 (.1), vacuolar H+-pumping ATPase 16 kDa proteolipid subunit 4 (.2) AT2G25610 55 / 7e-10 ATPase, F0/V0 complex, subunit C protein (.1) AT4G32530 55 / 9e-10 ATPase, F0/V0 complex, subunit C protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G082700 [exp] 226 / 8e-77 AT1G19910 221 / 9e-75 VACUOLAR-TYPE H+ ATPASE C2, ATPase, F0/V0 complex, subunit C protein (.1) Potri.002G027200 [exp] 225 / 2e-76 AT1G19910 226 / 9e-77 VACUOLAR-TYPE H+ ATPASE C2, ATPase, F0/V0 complex, subunit C protein (.1) Potri.007G014600 [exp] 223 / 8e-76 AT1G19910 224 / 5e-76 VACUOLAR-TYPE H+ ATPASE C2, ATPase, F0/V0 complex, subunit C protein (.1) Potri.004G163400 [exp] 223 / 2e-75 AT4G34720 224 / 4e-76 VACUOLAR H+-PUMPING ATPASE C1, ATPase, F0/V0 complex, subunit C protein (.1) Potri.009G125000 [exp] 222 / 1e-74 AT4G34720 226 / 4e-76 VACUOLAR H+-PUMPING ATPASE C1, ATPase, F0/V0 complex, subunit C protein (.1) Potri.006G248700 [exp] 54 / 2e-09 AT4G32530 281 / 3e-98 ATPase, F0/V0 complex, subunit C protein (.1.2) Potri.018G032600 [exp] 54 / 3e-09 AT2G25610 249 / 8e-86 ATPase, F0/V0 complex, subunit C protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10033179 [exp] 223 / 1e-75 AT1G19910 316 / 2e-112 VACUOLAR-TYPE H+ ATPASE C2, ATPase, F0/V0 complex, subunit C protein (.1) Lus10028367 [exp] 223 / 1e-75 AT1G19910 316 / 2e-112 VACUOLAR-TYPE H+ ATPASE C2, ATPase, F0/V0 complex, subunit C protein (.1) Lus10028370 [exp] 223 / 1e-75 AT1G19910 316 / 2e-112 VACUOLAR-TYPE H+ ATPASE C2, ATPase, F0/V0 complex, subunit C protein (.1) Lus10041819 [exp] 223 / 1e-75 AT1G19910 316 / 2e-112 VACUOLAR-TYPE H+ ATPASE C2, ATPase, F0/V0 complex, subunit C protein (.1) Lus10010618 [exp] 223 / 1e-75 AT1G19910 316 / 2e-112 VACUOLAR-TYPE H+ ATPASE C2, ATPase, F0/V0 complex, subunit C protein (.1) Lus10010619 [exp] 223 / 2e-75 AT1G19910 315 / 5e-112 VACUOLAR-TYPE H+ ATPASE C2, ATPase, F0/V0 complex, subunit C protein (.1) Lus10010623 [exp] 222 / 4e-75 AT1G19910 315 / 6e-112 VACUOLAR-TYPE H+ ATPASE C2, ATPase, F0/V0 complex, subunit C protein (.1) Lus10000347 [exp] 54 / 4e-09 AT4G32530 312 / 3e-110 ATPase, F0/V0 complex, subunit C protein (.1.2) Lus10000694 [exp] 54 / 4e-09 AT4G32530 312 / 3e-110 ATPase, F0/V0 complex, subunit C protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00137 [poplar] [flax] ATP-synt_C ATP synthase subunit C
Representative CDS sequence Show only first row Show all	>Potri.005G235300.1 pacid=42803097 polypeptide=Potri.005G235300.1.p locus=Potri.005G235300 ID=Potri.005G235300.1.v4.1 annot-version=v4.1 ATGTCTTCAACATTCAGTGGAGATGAAACTGCGCCGTTCTTCGGATTCCTTGGCGCTGCTGCCGCCCTCGTTTTCTCCTGCATGGGAGCTGCTTACGGTA CCGCGAAGAGTGGAGTTGGCGTTGCATCAATGGGTGTGATGCGACCAGAGCTCGTGATGAAATCCATAGTCCCGGTCGTTATGGCTGGAGTTTTGGGTAT ATACGGTCTGATTATTGCCGTGATTATCAGTACTGGTATTAACCCGAAGGCAAAATCCTATTATCTGTTCGATGGATATGCTCATCTTTCTTCTGGTCTC GCCTGTGGCCTCGCTGGTCTCTCTGCTGGTATGGCTATTGGCATCGTTGGTGATGCTGGTGTTAGAGCTAATGCCCAGCAACCAAAGCTTTTTGTTGGTA TGATCCTCATTCTCATCTTTGCTGAAGCACTGGCCCTTTACGGTCTCATTGTTGGCATCATTCTCTCCTCCCGAGCTGGTCAATCGAGAGCTGAGTAA
AA sequence Show only first row Show all	>Potri.005G235300.1 pacid=42803097 polypeptide=Potri.005G235300.1.p locus=Potri.005G235300 ID=Potri.005G235300.1.v4.1 annot-version=v4.1 MSSTFSGDETAPFFGFLGAAAALVFSCMGAAYGTAKSGVGVASMGVMRPELVMKSIVPVVMAGVLGIYGLIIAVIISTGINPKAKSYYLFDGYAHLSSGL ACGLAGLSAGMAIGIVGDAGVRANAQQPKLFVGMILILIFAEALALYGLIVGIILSSRAGQSRAE

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G19910		AVA-2PE, ATVHA-...	VACUOLAR-TYPE H+ ATPASE C2, AT...		Potri.005G235300 [exp]	0	1
AT4G28088			Low temperature and salt respo...		Potri.006G182500 [exp]	4.47	0.9270
AT1G26940			Cyclophilin-like peptidyl-prol...		Potri.010G012900 [exp]	5.65	0.9315
AT4G35335			Nucleotide-sugar transporter f...		Potri.016G113200 [exp]	6.70	0.9242
AT5G50460			secE/sec61-gamma protein trans...		Potri.001G329400 [exp]	8.24	0.9233
AT1G67785			unknown protein		Potri.015G087301 [exp]	10.00	0.9033
AT5G52210		ATGB1, ATARLB1	GTP-binding protein 1 (.1.2)		Potri.012G138500 [exp]	12.40	0.9096
AT4G29340		PRF4	profilin 4 (.1)		Potri.006G235200 [exp]	15.00	0.9183	Pt-PRO1.4
AT4G39220		ATRER1A	Rer1 family protein (.1)		Potri.004G156900 [exp]	15.09	0.9119	Pt-RER1.2
AT5G57815			Cytochrome c oxidase, subunit ...		Potri.018G099900 [exp]	15.23	0.8963
AT3G07950			rhomboid protein-related (.1)		Potri.010G220900 [exp]	18.81	0.9171

Compare expression of checked genes

Potri.005G235300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.