Potri.005G235700 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G10980 274 / 1e-96 Histone superfamily protein (.1)
AT4G40030 274 / 1e-96 Histone superfamily protein (.1.2.3)
AT4G40040 274 / 1e-96 Histone superfamily protein (.1.2)
AT1G09200 265 / 3e-93 Histone superfamily protein (.1)
AT3G27360 265 / 3e-93 Histone superfamily protein (.1)
AT5G10390 265 / 3e-93 Histone superfamily protein (.1)
AT5G10400 265 / 3e-93 Histone superfamily protein (.1)
AT5G65360 265 / 3e-93 Histone superfamily protein (.1)
AT1G75600 264 / 8e-93 Histone superfamily protein (.1)
AT5G65350 254 / 1e-88 HTR11 histone 3 11 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G072300 274 / 1e-96 AT5G10980 274 / 1e-96 Histone superfamily protein (.1)
Potri.007G096700 274 / 1e-96 AT5G10980 274 / 1e-96 Histone superfamily protein (.1)
Potri.007G014300 274 / 1e-96 AT5G10980 274 / 1e-96 Histone superfamily protein (.1)
Potri.002G026800 274 / 1e-96 AT5G10980 274 / 1e-96 Histone superfamily protein (.1)
Potri.002G100200 274 / 1e-96 AT5G10980 274 / 1e-96 Histone superfamily protein (.1)
Potri.014G096900 265 / 3e-93 AT5G65360 235 / 3e-81 Histone superfamily protein (.1)
Potri.002G028800 265 / 3e-93 AT5G65360 235 / 3e-81 Histone superfamily protein (.1)
Potri.003G210100 265 / 3e-93 AT5G65360 235 / 3e-81 Histone superfamily protein (.1)
Potri.003G207852 265 / 3e-93 AT5G65360 235 / 3e-81 Histone superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10031822 265 / 3e-93 AT5G10400 271 / 1e-95 Histone superfamily protein (.1)
Lus10005271 265 / 3e-93 AT1G09200 271 / 1e-95 Histone superfamily protein (.1)
Lus10005270 265 / 3e-93 AT1G09200 271 / 1e-95 Histone superfamily protein (.1)
Lus10031250 265 / 3e-93 AT1G09200 271 / 1e-95 Histone superfamily protein (.1)
Lus10025439 265 / 3e-93 AT5G65360 271 / 1e-95 Histone superfamily protein (.1)
Lus10031821 267 / 5e-93 AT3G27360 273 / 3e-95 Histone superfamily protein (.1)
Lus10012744 265 / 6e-93 AT5G65360 271 / 2e-95 Histone superfamily protein (.1)
Lus10013948 265 / 6e-92 AT3G27360 272 / 7e-95 Histone superfamily protein (.1)
Lus10031252 262 / 6e-92 AT3G27360 268 / 2e-94 Histone superfamily protein (.1)
Lus10000284 229 / 4e-79 AT4G40030 229 / 3e-79 Histone superfamily protein (.1.2.3)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0012 Histone PF00125 Histone Core histone H2A/H2B/H3/H4
Representative CDS sequence
>Potri.005G235700.1 pacid=42803955 polypeptide=Potri.005G235700.1.p locus=Potri.005G235700 ID=Potri.005G235700.1.v4.1 annot-version=v4.1
ATGGCTCGTACCAAGCAAACTGCCCGTAAATCAACCGGTGGTAAGGCGCCAAGGAAGCAGCTCGCCACCAAGGCTGCAAGAAAATCTGCTCCTACTACCG
GTGGGGTCAAGAAGCCTCACCGTTATCGCCCTGGAACTGTTGCTCTCCGTGAAATCCGGAAGTACCAAAAGAGCACTGAGCTTTTGATCCGCAAGTTACC
TTTCCAGCGACTTGTTCGTGAAATTGCTCAAGACTTCAAGACTGATTTGAGGTTCCAGAGCCATGCTGTCCTTGCACTCCAGGAGGCTGCTGAGGCTTAT
CTCGTGGGTCTGTTTGAGGACACCAACTTGTGTGCTATTCATGCCAAGAGAGTCACCATCATGCCTAAGGACATCCAGCTTGCTAGGCGTATCCGTGGTG
AACGTGCTTAA
AA sequence
>Potri.005G235700.1 pacid=42803955 polypeptide=Potri.005G235700.1.p locus=Potri.005G235700 ID=Potri.005G235700.1.v4.1 annot-version=v4.1
MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAY
LVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G10980 Histone superfamily protein (.... Potri.005G235700 0 1
AT5G18470 Curculin-like (mannose-binding... Potri.001G437875 4.69 0.7968
AT4G09760 Protein kinase superfamily pro... Potri.005G197500 36.40 0.7822
AT2G16600 ROC3 rotamase CYP 3 (.1.2) Potri.002G021500 41.32 0.7784 CYP1.2
AT4G36550 ARM repeat superfamily protein... Potri.005G122100 85.74 0.7047
AT2G30140 UDP-Glycosyltransferase superf... Potri.001G282100 115.09 0.7415
AT1G61250 SC3 secretory carrier 3 (.1.2) Potri.011G045100 115.27 0.7167 PSAM2.2
AT1G12710 ATPP2-A12 phloem protein 2-A12 (.1) Potri.003G121900 127.16 0.6816
AT5G42300 UBL5 ubiquitin-like protein 5 (.1) Potri.008G039100 130.13 0.7100
AT5G49230 HRB1 HYPERSENSITIVE TO RED AND BLUE... Potri.008G213400 134.53 0.6941
AT3G01400 ARM repeat superfamily protein... Potri.014G016400 141.93 0.7203

Potri.005G235700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.