Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	SAUR31
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G75580 163 / 8e-54 SAUR-like auxin-responsive protein family (.1) AT4G34760 159 / 3e-52 SAUR-like auxin-responsive protein family (.1) AT2G21220 157 / 2e-51 SAUR-like auxin-responsive protein family (.1) AT4G38860 154 / 3e-50 SAUR-like auxin-responsive protein family (.1) AT1G19830 151 / 4e-49 SAUR-like auxin-responsive protein family (.1) AT2G16580 147 / 3e-47 SAUR-like auxin-responsive protein family (.1) AT2G18010 132 / 1e-41 SAUR-like auxin-responsive protein family (.1) AT4G36110 130 / 8e-41 SAUR-like auxin-responsive protein family (.1) AT5G66260 104 / 2e-30 SAUR-like auxin-responsive protein family (.1) AT3G20220 84 / 2e-22 SAUR-like auxin-responsive protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G024300 [exp] 209 / 6e-72 AT1G75580 170 / 2e-56 SAUR-like auxin-responsive protein family (.1) Potri.004G164400 [exp] 177 / 2e-59 AT4G34760 182 / 4e-61 SAUR-like auxin-responsive protein family (.1) Potri.009G126000 [exp] 175 / 1e-58 AT4G34760 179 / 4e-60 SAUR-like auxin-responsive protein family (.1) Potri.007G012800 [exp] 163 / 7e-54 AT4G34760 164 / 3e-54 SAUR-like auxin-responsive protein family (.1) Potri.009G127400 [exp] 89 / 2e-24 AT4G34770 111 / 3e-33 SAUR-like auxin-responsive protein family (.1) Potri.004G165600 [exp] 86 / 2e-23 AT4G34770 118 / 4e-36 SAUR-like auxin-responsive protein family (.1) Potri.004G165900 [exp] 84 / 1e-22 AT4G34770 99 / 9e-29 SAUR-like auxin-responsive protein family (.1) Potri.009G127300 [exp] 84 / 1e-22 AT2G21210 104 / 8e-31 SAUR-like auxin-responsive protein family (.1) Potri.004G164800 [exp] 82 / 1e-21 AT4G38840 120 / 3e-37 SAUR-like auxin-responsive protein family (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10012432 [exp] 157 / 5e-51 AT1G75580 164 / 9e-54 SAUR-like auxin-responsive protein family (.1) Lus10024326 [exp] 155 / 3e-50 AT1G75580 166 / 2e-54 SAUR-like auxin-responsive protein family (.1) Lus10034511 [exp] 153 / 2e-49 AT1G75580 161 / 9e-53 SAUR-like auxin-responsive protein family (.1) Lus10033159 [exp] 150 / 2e-48 AT1G75580 160 / 1e-52 SAUR-like auxin-responsive protein family (.1) Lus10012189 [exp] 145 / 2e-46 AT4G34760 169 / 3e-56 SAUR-like auxin-responsive protein family (.1) Lus10007553 [exp] 139 / 3e-44 AT4G34760 168 / 9e-56 SAUR-like auxin-responsive protein family (.1) Lus10028466 [exp] 121 / 4e-37 AT4G34760 151 / 5e-49 SAUR-like auxin-responsive protein family (.1) Lus10026296 [exp] 121 / 4e-37 AT4G34760 133 / 4e-42 SAUR-like auxin-responsive protein family (.1) Lus10041921 [exp] 114 / 3e-34 AT4G34760 144 / 7e-46 SAUR-like auxin-responsive protein family (.1) Lus10032173 [exp] 85 / 2e-22 AT4G38840 119 / 3e-36 SAUR-like auxin-responsive protein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02519 [poplar] [flax] Auxin_inducible Auxin responsive protein
Representative CDS sequence Show only first row Show all	>Potri.005G237200.1 pacid=42802694 polypeptide=Potri.005G237200.1.p locus=Potri.005G237200 ID=Potri.005G237200.1.v4.1 annot-version=v4.1 ATGGTCATCAGGAAATCAAACAGGCTGCCTCAAACAGCAGTTATCAGGCAGATCCTCAAGAGGTGCTCAAGCTTGGGAAAGAAACAAGGGTATCATGACC AAGAAGGCCTTCCTTTGGACGTTCCAAAGGGTCACTTTGTTGTATATGTCGGTGAAAACAGAAGCAGATACATTGTGCCCATCTCTATCTTGAGTAGTCC CGAGTTTCAGACTTTGCTTCAACAAGCAGAAGAAGAGTTCGGGTTTGATCATGATATGGGCCTTACCATTCCTTGTGAAGAAGTTGTTTTCCAGTCCATT CTGATCAGATACTGA
AA sequence Show only first row Show all	>Potri.005G237200.1 pacid=42802694 polypeptide=Potri.005G237200.1.p locus=Potri.005G237200 ID=Potri.005G237200.1.v4.1 annot-version=v4.1 MVIRKSNRLPQTAVIRQILKRCSSLGKKQGYHDQEGLPLDVPKGHFVVYVGENRSRYIVPISILSSPEFQTLLQQAEEEFGFDHDMGLTIPCEEVVFQSI LIRY

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G75580			SAUR-like auxin-responsive pro...		Potri.005G237200 [exp]	0	1	SAUR31
AT2G42840		PDF1	protodermal factor 1 (.1)		Potri.002G060800 [exp]	3.00	0.9827
AT1G29670			GDSL-like Lipase/Acylhydrolase...		Potri.019G008000 [exp]	3.16	0.9800
AT1G69560	MYB	LOF2, ATMYB105	LATERAL ORGAN FUSION 2, myb do...		Potri.010G167500 [exp]	4.89	0.9711
AT1G14820			Sec14p-like phosphatidylinosit...		Potri.010G105400 [exp]	4.89	0.9751
AT5G04370		NAMT1	S-adenosyl-L-methionine-depend...		Potri.019G022200 [exp]	5.29	0.9636
AT1G31710			Copper amine oxidase family pr...		Potri.010G089050 [exp]	6.70	0.9710
AT1G69560	MYB	LOF2, ATMYB105	LATERAL ORGAN FUSION 2, myb do...		Potri.008G088000 [exp]	7.34	0.9543
AT5G47000			Peroxidase superfamily protein...		Potri.007G074700 [exp]	9.16	0.9416
					Potri.007G016532 [exp]	9.16	0.9700
AT1G68620			alpha/beta-Hydrolases superfam...		Potri.003G192600 [exp]	10.67	0.9709

Compare expression of checked genes

Potri.005G237200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.